5-HT1F Recombinant Protein Antigen

Images

 
There are currently no images for 5-HT1F Protein (NBP1-90319PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

5-HT1F Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HTR1F.

Source: E. coli

Amino Acid Sequence: AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HTR1F
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90319.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 5-HT1F Recombinant Protein Antigen

  • 5HT1F
  • 5-HT1F
  • 5-HT-1F
  • 5HT6
  • 5-hydroxytryptamine (serotonin) receptor 1F
  • HTR1EL
  • HTR1ELMR77,5-HT1F5-hydroxytryptamine receptor 1F
  • HTR1F
  • MR77
  • Serotonin receptor 1F

Background

The members of the G protein-coupled receptor family are distinguished by their slow transmitting response to ligand binding. These seven transmembrane proteins include the adrenergic, serotonin and dopamine receptors. The effect of the signaling molecule can be excitatory or inhibitory depending on the type of receptor to which it binds. beta-adrenergic bound to adrenaline activates adenylyl cyclase, while alpha2-adrenergic receptor bound to adrenaline inhibits adenylyl cyclase. Like the alpha2-adrenergic receptor, serotonin receptor functions are also mediated by G proteins that inhibit the activity of adenylyl cyclase. The serotonin receptors have been classified into several categories, designated SR-17 (5HT17). Subtypes within the SR-1 group include SR-1A, -1B, -1D, -1E and -1F.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-21590
Species: Hu, Mu
Applications: ICC/IF, Simple Western, WB
NLS590
Species: Hu, Pm
Applications: IHC,  IHC-P
NB100-56352
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, Simple Western, WB
NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
MAB5764
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NBP1-46557
Species: Mu, Rt
Applications: IHC, WB
NBP1-90320
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-55429
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-78403
Species: Hu
Applications: ICC/IF, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB

Publications for 5-HT1F Protein (NBP1-90319PEP) (0)

There are no publications for 5-HT1F Protein (NBP1-90319PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT1F Protein (NBP1-90319PEP) (0)

There are no reviews for 5-HT1F Protein (NBP1-90319PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 5-HT1F Protein (NBP1-90319PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-HT1F Products

Array NBP1-90319PEP

Research Areas for 5-HT1F Protein (NBP1-90319PEP)

Find related products by research area.

Blogs on 5-HT1F

There are no specific blogs for 5-HT1F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 5-HT1F Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR1F