Home » 5-HT1F » 5-HT1F Proteins » 5-HT1F Recombinant Protein Antigen

5-HT1F Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for 5-HT1F Protein (NBP1-90319PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

5-HT1F Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HTR1F.

Source: E.coli

Amino Acid Sequence: AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HTR1F
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90319.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for 5-HT1F Recombinant Protein Antigen

  • 5HT1F
  • 5-HT1F
  • 5-HT-1F
  • 5HT6
  • 5-hydroxytryptamine (serotonin) receptor 1F
  • HTR1EL
  • HTR1ELMR77,5-HT1F5-hydroxytryptamine receptor 1F
  • HTR1F
  • MR77
  • Serotonin receptor 1F

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

5-HT1B Antibody
NB100-56350
Western Blot: 5-HT1B Antibody [NB100-56350] - Analysis of 5-HT1B in human brain lysate with anti-5-HT1BR pcAb (NB100-56350). A protein band of approximate molecular weight of 40-41kDa was detected.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
5-HT1A Antibody
NBP2-21590
Immunocytochemistry/Immunofluorescence: 5-HT1A Antibody [NBP2-21590] - DIV14 rat E18 primary cortical neurons were fixed in 4% paraformaldehyde at RT for 15 min. Green: 5-HT1A receptor protein stained by 5-HT1A receptor antibody [N3C1], Internal diluted at 1:500. Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Frozen: 5-HT1A Antibody [NBP2-21590] - Frozen Sectioned adult mouse hippocampus. Green: 5-HT1A receptor protein stained by 5-HT1A receptor antibody [N3C1], Internal diluted at 1:250.Blue: Fluoroshield with DAPI.
Western Blot: 5-HT1A Antibody [NBP2-21590] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with 5-HT1A receptor antibody [N3C1], Internal diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
5-HT1D Antibody
NLS590
Immunohistochemistry-Paraffin: 5-HT1D Antibody [NLS590] - Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Immunohistochemistry-Paraffin: 5-HT1D Antibody [NLS590] - Human Pancreas, Islet: Formalin-Fixed, Paraffin-Embedded (FFPE)
Immunohistochemistry-Paraffin: 5-HT1D Antibody [NLS590] - Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Hu, Pm
Applications: IHC, IHC-P
5-HT7 Antibody
NB100-56352
Western Blot: 5-HT7 Antibody [NB100-56352] - Analysis of 5-HT7R in A) human brain, B) mouse brain, C) rat brain, and D) human SK-N-SH neuroblastoma cell lysate using this antibody.
(17 Publications)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
5-HT2A Antibody
NBP2-26091
Immunocytochemistry/Immunofluorescence: 5-HT2A Antibody [NBP2-26091] - Immunofluorescence analysis of paraformaldehyde fixed A549 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Flow Cytometry: 5-HT2A Antibody [NBP2-26091] - Flow cytometric analysis of paraformaldehyde fixed A549 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP2-26091] - Negative Control showing staining of paraffin embedded Human Cerebellum, with no primary antibody.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
5-HT2C Antibody
(496214)
MAB5764
A172 human glioblastoma cell line was stained with Mouse Anti-Human 5HT2C Monoclonal Antibody (Catalog # MAB5764, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
5HT2C was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Mouse Anti-Human 5HT2C Monoclonal Antibody (Catalog # MAB5764) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: CyTOF-ready, Flow, IHC
5-HT6 Antibody
NBP1-46557
Immunohistochemistry: 5-HT6 Antibody [NBP1-46557] - The 5-HT6 Receptor Is highly expressed in human tissue grafts originating from both fetal and hESC. Immunofluorescence staining of 5-HT6 expression in a human dopaminergic fetal graft within the rat striatum with the phenotypic staining for TH , and the identification of human NCAM, imaged using LSM. Image collected and cropped by CiteAb from the following publication (linkinghub.elsevier.com/retrieve/pii/S0896627316300769), licensed under a CC-BY licence.
Immunohistochemistry: 5-HT6 Antibody [NBP1-46557] - LSM image showing strong expression of 5-HT6 (red) colocalized with virally transduced (green) TH (blue)-positive neurons within the dopaminergic fetal graft. Image collected and cropped by CiteAb from the following publication (linkinghub.elsevier.com/retrieve/pii/S0896627316300769), licensed under a CC-BY licence.
(3 Publications)
Species: Mu, Rt
Applications: IHC, WB
5-HT1E Antibody
NBP1-90320
Western Blot: 5-HT1E Antibody [NBP1-90320] - Analysis in control (vector only transfected HEK293T lysate) and HTR1E over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: 5-HT1E Antibody [NBP1-90320] - Staining of human endometrium shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: 5-HT1E Antibody [NBP1-90320] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Species: Hu
Applications: IHC, IHC-P, WB
5-HT2B Antibody
NBP1-90322
Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining of human endometrium shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
5-HT4 Antibody
NBP1-78403
Immunocytochemistry/Immunofluorescence: 5-HT4 Antibody [NBP1-78403] - Staining of 5HT4 receptor in HeLa cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Western Blot: 5-HT4 Antibody [NBP1-78403] - Western Blot Image of anti-5HT4 Receptor. Total protein from human liver tissue was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-LYVE1 in 1% milk/TBST. Reactivity was detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Species: Hu
Applications: ICC/IF, WB
GR/NR3C1 Antibody
(BuGR2)
NB300-731
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - An intracellular stain was performed on Jurkat cells with GR/NR3C1 (BuGR2) antibody NB300-731PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerthrin.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in A549 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(6 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Glutathione
Reductase Antibody
NBP2-16684
Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Mouse tissue extract (50 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Glutathione reductase diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Mouse tissue extract (50 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Glutathione reductase diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Glutathione Reductase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
EN-RAGE/S100A12
Antibody [Unconjugate
AF1052
EN‑RAGE/S100A12 was detected in immersion fixed paraffin-embedded sections of human tonsil using 15 µg/mL Goat Anti-Human EN‑RAGE/S100A12 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1052) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysate of human granulocytes. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EN‑RAGE/S100A12 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1052) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EN‑RAGE/S100A12 at approximately 10 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB

Publications for 5-HT1F Protein (NBP1-90319PEP) (0)

There are no publications for 5-HT1F Protein (NBP1-90319PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT1F Protein (NBP1-90319PEP) (0)

There are no reviews for 5-HT1F Protein (NBP1-90319PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 5-HT1F Protein (NBP1-90319PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional 5-HT1F Products

Array NBP1-90319PEP

Bioinformatics Tool for 5-HT1F Protein (NBP1-90319PEP)

Discover related pathways, diseases and genes to 5-HT1F Protein (NBP1-90319PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT1F Protein (NBP1-90319PEP)

Discover more about diseases related to 5-HT1F Protein (NBP1-90319PEP).
 

Pathways for 5-HT1F Protein (NBP1-90319PEP)

View related products by pathway.

Research Areas for 5-HT1F Protein (NBP1-90319PEP)

Find related products by research area.

Blogs on 5-HT1F

There are no specific blogs for 5-HT1F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - An intracellular stain was performed on Jurkat cells with GR/NR3C1 (BuGR2) antibody NB300-731PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerthrin.
GR/NR3C1 Antibody (BuGR2)
NB300-731

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 5-HT1F Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HTR1F