Recombinant Human 5-HT1F Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human 5-HT1F Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 203 - 279 of Human HTR1F partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HTR1F

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5-HT1F Protein

  • 5HT1F
  • 5-HT1F
  • 5-HT-1F
  • 5HT6
  • 5-hydroxytryptamine (serotonin) receptor 1F
  • HTR1EL
  • HTR1ELMR77,5-HT1F5-hydroxytryptamine receptor 1F
  • HTR1F
  • MR77
  • Serotonin receptor 1F

Background

HTR1F - 5-hydroxytryptamine (serotonin) receptor 1F

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56349
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC
NBP1-90320
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55429
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
NB120-16007
Species: Hu, Mu, Po, Ch, RM
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00003355-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for 5-HT1F Partial Recombinant Protein (H00003355-Q01) (0)

There are no publications for 5-HT1F Partial Recombinant Protein (H00003355-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT1F Partial Recombinant Protein (H00003355-Q01) (0)

There are no reviews for 5-HT1F Partial Recombinant Protein (H00003355-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5-HT1F Partial Recombinant Protein (H00003355-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-HT1F Products

Bioinformatics Tool for 5-HT1F Partial Recombinant Protein (H00003355-Q01)

Discover related pathways, diseases and genes to 5-HT1F Partial Recombinant Protein (H00003355-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT1F Partial Recombinant Protein (H00003355-Q01)

Discover more about diseases related to 5-HT1F Partial Recombinant Protein (H00003355-Q01).
 

Pathways for 5-HT1F Partial Recombinant Protein (H00003355-Q01)

View related products by pathway.

Research Areas for 5-HT1F Partial Recombinant Protein (H00003355-Q01)

Find related products by research area.

Blogs on 5-HT1F

There are no specific blogs for 5-HT1F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

5-HT7 Antibody
NB100-56352

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 5-HT1F Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR1F
Entrez