Home » 15-Lipoxygenase 1 » 15-Lipoxygenase 1 Antibodies » 15-Lipoxygenase 1 Antibody (3D8)

15-Lipoxygenase 1 Antibody (3D8)

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: 15-Lipoxygenase 1 Antibody (3D8) [H00000246-M04] - Analysis of ALOX15 expression in Hela S3 NE (Cat # L013V3).
Western Blot: 15-Lipoxygenase 1 Antibody (3D8) [H00000246-M04] - Analysis of ALOX15 expression in Hela S3 NE (Cat # L013V3).
Immunohistochemistry-Paraffin: 15-Lipoxygenase 1 Antibody (3D8) [H00000246-M04] - Analysis of monoclonal antibody to ALOX15 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml
ELISA: 15-Lipoxygenase 1 Antibody (3D8) [H00000246-M04] - Detection limit for recombinant GST tagged ALOX15 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

15-Lipoxygenase 1 Antibody (3D8) Summary

Immunogen
ALOX15 (AAH29032, 1 a.a. ~ 662 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
Specificity
arachidonate 15-lipoxygenase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALOX15
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using
H00000246-M04 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 15-Lipoxygenase 1 Antibody (3D8)

  • 15-lipooxygenase-1
  • 15-LOX-1
  • 15LOX-1
  • arachidonate 15-lipoxygenase
  • Arachidonate omega-6 lipoxygenase
  • EC 1.13.11
  • EC 1.13.11.33
  • LOG15,15-LOX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

12-Lipoxygenase
Antibody (OTI1C3)
NBP2-46512
Western Blot: 12-Lipoxygenase Antibody (1C3) [NBP2-46512] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY 12-Lipoxygenase.
Immunohistochemistry-Paraffin: 12-Lipoxygenase Antibody (1C3) [NBP2-46512] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry-Paraffin: 12-Lipoxygenase Antibody (1C3) [NBP2-46512] - Analysis of Human lung tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
5-Lipoxygenase
Antibody
NB110-58748
Western Blot: 5-Lipoxygenase Antibody [NB110-58748] - Detection of LOX5 in human peripheral leukocytes using NB110-58748 at 0.5(Lane 1) and 2.0 ug/ml (Lane 2).
Immunocytochemistry/Immunofluorescence: 5-Lipoxygenase Antibody [NB110-58748] - 5-Lipoxygenase antibody was tested in Hela cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Simple Western: 5-Lipoxygenase Antibody [NB110-58748] - Simple Western lane view shows a specific band for 5-Lipoxygenase in 0.5 mg/ml of Human Lung lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody
(2 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
LOX Antibody
NB100-2527
Western Blot: LOX Antibody [NB100-2527] - LOX secretion and activity in response to tumor cell irradiation. Western blot of LOX zymogen (50 kDa) and active form (32 kDa) in conditioned media derived from irradiated A549 lung carcinoma cells 16-20 h after irradiation and quantification of band intensities from 3 independent experiments. Image collected and cropped by CiteAb from the following publication (http://bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-532) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: LOX Antibody [NB100-2527] - Expression of Lox and Loxl1-Loxl4 mRNAs in orthotopic rat prostate tumours and in the surrounding normal rat prostate tissue. Representative sections from a 10-day orthotopic AT-1 rat prostate tumour (T), tumour-adjacent normal rat prostate tissue (N), and tumour-free control rat prostate tissue stained for LOX (inserts show LOX staining in higher magnifications). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep19608), licensed under a CC-BY licence.
Simple Western: LOX Antibody [NB100-2527] - Simple Western shows a specific band for LOX in 1.0 mg/ml of HeLa cell lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(5 Reviews)
(27 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
15-Lipoxygenase 2
Antibody
NBP2-58984
Immunocytochemistry/Immunofluorescence: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining of human cell line hTCEpi shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining in human prostate and endometrium tissues using anti-ALOX15B antibody. Corresponding ALOX15B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining of human endometrium shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
IL-4 [Unconjugated]
6507-IL/CF
IL-4 [Unconjugated]
(3 Publications)
Species: Hu
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody (NB100-689).
Simple Western: COX-2 Antibody [NB100-689] - Simple Western lane view shows a specific band for COX2 in 1.0 mg/ml of Rat Brain at an antibody concentration of 1:100. This experiment was performed under reducing conditions using the 12-230 kDa separation system. Image provided through customer review.
(1 Review)
(29 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
5-Lipoxygenase
Antibody
NB110-58748
Western Blot: 5-Lipoxygenase Antibody [NB110-58748] - Detection of LOX5 in human peripheral leukocytes using NB110-58748 at 0.5(Lane 1) and 2.0 ug/ml (Lane 2).
Immunocytochemistry/Immunofluorescence: 5-Lipoxygenase Antibody [NB110-58748] - 5-Lipoxygenase antibody was tested in Hela cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Simple Western: 5-Lipoxygenase Antibody [NB110-58748] - Simple Western lane view shows a specific band for 5-Lipoxygenase in 0.5 mg/ml of Human Lung lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody
(2 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
IL-13 [HRP]
M1300CB
(3 Reviews)
(113 Publications)
Species: Mu
TEF1 Antibody
NBP2-94035
Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEF1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 120s.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunohistochemistry-Paraffin: TEF1 Antibody [NBP2-94035] - Paraffin-embedded mouse lung using TEF1.
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
CPOX Antibody
(36B10)
NBP2-59438
Western Blot: CPOX Antibody (36B10) [NBP2-59438] - Lane 1: Recombinant protein CPOX, Lane 2: 293T cell lysates, Lane 3: HepG2 cell lysates, Lane 4: A549 cell lysates, Lane 5: Jurkat cell lysates, Lane 6: K562 cell lysates, Lane 7: LnCaP cell lysates
Immunocytochemistry/Immunofluorescence: CPOX Antibody (36B10) [NBP2-59438] - Analysis of CPOX in Hep3B cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CPOX antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Species: Hu
Applications: WB, ELISA, ICC/IF
Recombinant Human
COX8A GST (N-Term) Pr ...
H00001351-P01
SDS-Page: COX8A Recombinant Protein [H00001351-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
COX5A Antibody
NBP1-32550
Western Blot: COX5A Antibody [NBP1-32550] - Sample(30 ug whole cell lysate)A:HeLa S3 B:Hep G2 15% SDS PAGE, antibody diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: COX5A Antibody [NBP1-32550] - A431.
Immunohistochemistry-Paraffin: COX5A Antibody [NBP1-32550] - Paraffin-embedded mouse cervix. COX5A antibody [N1C3] diluted at 1:500.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
CCL2/JE/MCP-1 [HRP]
DCP00
(7 Reviews)
(183 Publications)
Species: Hu
COX-1 Antibody
NBP1-85500
Western Blot: COX-1 Antibody [NBP1-85500] - Analysis in human cell line HELA.
Immunocytochemistry/Immunofluorescence: COX-1 Antibody [NBP1-85500] - Validation of gene expression changes from RNA-Seq experiments. b, d Cox1 and Krt5 expression in a control (b) and in the ShhCre;Ppargfl/fl mutant urothelium (d). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-019-12332-0), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining in human skin and skeletal muscle tissues using anti-PTGS1 antibody. Corresponding PTGS1 RNA-seq data are presented for the same tissues.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
15-Lipoxygenase 1
Antibody (3D8)
H00000246-M04
15-Lipoxygenase 1 Antibody (3D8)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for 15-Lipoxygenase 1 Antibody (H00000246-M04)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for 15-Lipoxygenase 1 Antibody (H00000246-M04) (0)

There are no reviews for 15-Lipoxygenase 1 Antibody (H00000246-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 15-Lipoxygenase 1 Antibody (H00000246-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional 15-Lipoxygenase 1 Products

Bioinformatics Tool for 15-Lipoxygenase 1 Antibody (H00000246-M04)

Discover related pathways, diseases and genes to 15-Lipoxygenase 1 Antibody (H00000246-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 15-Lipoxygenase 1 Antibody (H00000246-M04)

Discover more about diseases related to 15-Lipoxygenase 1 Antibody (H00000246-M04).
 

Pathways for 15-Lipoxygenase 1 Antibody (H00000246-M04)

View related products by pathway.

PTMs for 15-Lipoxygenase 1 Antibody (H00000246-M04)

Learn more about PTMs related to 15-Lipoxygenase 1 Antibody (H00000246-M04).
 

Research Areas for 15-Lipoxygenase 1 Antibody (H00000246-M04)

Find related products by research area.

Blogs on 15-Lipoxygenase 1

There are no specific blogs for 15-Lipoxygenase 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 15-Lipoxygenase 1 Antibody (3D8) and receive a gift card or discount.


Bioinformatics

Gene Symbol ALOX15
Entrez
OMIM
Uniprot