14-3-3 gamma Recombinant Protein Antigen

Images

 
There are currently no images for 14-3-3 gamma Recombinant Protein Antigen (NBP2-54679PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

14-3-3 gamma Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 14-3-3 gamma

Source: E. coli

Amino Acid Sequence: EAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
YWHAG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54679.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 14-3-3 gamma Recombinant Protein Antigen

  • 1433 gamma
  • 14-3-3 gamma
  • 14-3-3 protein gamma
  • 14-3-3GAMMA
  • KCIP-1
  • Protein kinase C inhibitor protein 1
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gammapolypeptide
  • YWHAG

Background

14-3-3 protein gamma is a member of the 14-3-3 family of proteins which help mediate signal transduction. Specifically, 14-3-3 gamma is an adapter protein responsible for bringing signal transduction to completion. It therefore plays an important role in regulating many fundamental cellular processes, such as apoptosis and cell-cycle checkpoints.

Signal-induced phosphorylation has the ability to change protein function, however phosphorylation is not always enough to change a protein's function. 14-3-3 gamma has the ability to bind a large number of target proteins thereby affecting the proteins' activity and/or function.

14-3-3 gamma is highly expressed in brain, heart and skeletal muscle, where it is induced by growth factors in human vascular smooth muscle cells. This suggests that 14-3-3 gamma may play a role in muscle tissue function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-24593
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-32695
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB4459
Species: Hu, Mu, Rt
Applications: WB
203-IL
Species: Hu
Applications: BA

Publications for 14-3-3 gamma Recombinant Protein Antigen (NBP2-54679PEP) (0)

There are no publications for 14-3-3 gamma Recombinant Protein Antigen (NBP2-54679PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 gamma Recombinant Protein Antigen (NBP2-54679PEP) (0)

There are no reviews for 14-3-3 gamma Recombinant Protein Antigen (NBP2-54679PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 14-3-3 gamma Recombinant Protein Antigen (NBP2-54679PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 14-3-3 gamma Products

Research Areas for 14-3-3 gamma Recombinant Protein Antigen (NBP2-54679PEP)

Find related products by research area.

Blogs on 14-3-3 gamma

There are no specific blogs for 14-3-3 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 14-3-3 gamma Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol YWHAG