12-Lipoxygenase Recombinant Protein Antigen

Images

 
There are currently no images for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

12-Lipoxygenase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 12-Lipoxygenase

Source: E.coli

Amino Acid Sequence: PGDNALDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLS

Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALOX12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP3-17678. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 12-Lipoxygenase Recombinant Protein Antigen

  • 12(S)-lipoxygenase
  • 12-Lipoxygenase
  • 12LO
  • 12-LOX
  • 12S-lipoxygenase
  • 12S-LOX
  • 12S-LOXarachidonate 12-lipoxygenase, 12S-type
  • ALOX12
  • arachidonate 12-lipoxygenase
  • EC 1.13.11
  • EC 1.13.11.-
  • EC 1.13.11.31
  • EC 1.13.11.33
  • EC 3.3.2.-
  • LOG12
  • platelet 12-LOX
  • platelet-type 12-lipoxygenase
  • Platelet-type lipoxygenase 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01740
Species: Ca, Hu, Pm, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
NB100-2527
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
H00001351-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-32550
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
236-EG
Species: Hu
Applications: BA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-92668
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-17678PEP
Species: Hu
Applications: AC

Publications for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP) (0)

There are no publications for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP) (0)

There are no reviews for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 12-Lipoxygenase Products

Bioinformatics Tool for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP)

Discover related pathways, diseases and genes to 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP)

Discover more about diseases related to 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP).
 

Pathways for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP)

View related products by pathway.

PTMs for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP)

Learn more about PTMs related to 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP).
 

Research Areas for 12-Lipoxygenase Recombinant Protein Antigen (NBP3-17678PEP)

Find related products by research area.

Blogs on 12-Lipoxygenase

There are no specific blogs for 12-Lipoxygenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 12-Lipoxygenase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX12