Recombinant Human 12-Lipoxygenase Protein

Images

 
Western Blot: 12 Lipoxygenase Partial Recombinant Protein [H00000239-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human 12-Lipoxygenase Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human ALOX12 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALOX12
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 12-Lipoxygenase Protein

  • 12(S)-lipoxygenase
  • 12-LOX
  • 12S-lipoxygenase
  • 12S-LOXarachidonate 12-lipoxygenase, 12S-type
  • arachidonate 12-lipoxygenase
  • EC 1.13.11
  • EC 1.13.11.31
  • LOG12
  • platelet 12-LOX
  • platelet-type 12-lipoxygenase
  • Platelet-type lipoxygenase 12

Background

ALOX12 - arachidonate 12-lipoxygenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01740
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000247-M05
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01) (0)

There are no publications for 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01) (0)

There are no reviews for 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 12-Lipoxygenase Products

Bioinformatics Tool for 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01)

Discover related pathways, diseases and genes to 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01)

Discover more about diseases related to 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01).
 

Pathways for 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01)

View related products by pathway.

PTMs for 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01)

Learn more about PTMs related to 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01).
 

Research Areas for 12-Lipoxygenase Partial Recombinant Protein (H00000239-Q01)

Find related products by research area.

Blogs on 12-Lipoxygenase

There are no specific blogs for 12-Lipoxygenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 12-Lipoxygenase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX12