ZSCAN1 Antibody (7C1) - Azide and BSA Free

Sandwich ELISA: ZSCAN1 Antibody (7C1) [H00284312-M02] - Detection limit for recombinant GST tagged ZSCAN1 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 7C1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZSCAN1 Antibody (7C1) - Azide and BSA Free Summary

• Immunogen: ZSCAN1 (NP_872378, 315 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. REEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHTAHGH
• Specificity: ZSCAN1 - zinc finger and SCAN domain containing 1
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZSCAN1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZSCAN1 Antibody (7C1) - Azide and BSA Free

• FLJ33779
• MGC104472
• MZF-1
• zinc finger and SCAN domain containing 1
• zinc finger and SCAN domain-containing protein 1
• zinc finger with SCAN domain 1
• ZNF915

Background

"ZSCAN1 may be involved in transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZSCAN1
• Entrez:
  • 284312(Human)
• Uniprot:
  • NP_872378(Human)