ZRSR2 Antibody - Azide and BSA Free

Western Blot: ZRSR2 Antibody [H00008233-B01P] - Analysis of U2AF1L2 expression in human placenta.

Western Blot: ZRSR2 Antibody [H00008233-B01P] - Analysis of ZRSR2 expression in transfected 293T cell line by ZRSR2 polyclonal antibody. Lane 1: U2AF1L2 transfected lysate(53.02 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZRSR2 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: U2AF1L2 (NP_005080, 1 a.a. - 482 a.a.) full-length human protein. MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
• Specificity: U2(RNU2) small nuclear RNA auxiliary factor 1-like 2
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ZRSR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate and tissue lysate for WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZRSR2 Antibody - Azide and BSA Free

• CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 2
• Renal carcinoma antigen NY-REN-20
• U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-relatedprotein 2
• U2 small nuclear ribonucleoprotein auxiliary factor, small subunit 2
• U2(RNU2) small nuclear RNA auxiliary factor 1-like 2MGC142014
• U2AF1L2
• U2AF1RS2MGC142040
• U2AF1-RS2U2AF35-related protein
• URPU2 small nuclear RNA auxiliary factor 1-like 2
• zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2

Background

This gene encodes an essential splicing factor. The encoded protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing, and may play a role in network interactions during spliceosome assembly. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZRSR2
• Entrez:
  • 8233(Human)
• Uniprot:
  • NP_005080(Human)