U2AF1L4 Antibody - Azide and BSA Free

Western Blot: U2AF1L4 Antibody [H00199746-B01P] - Analysis of U2AF1L4 expression in transfected 293T cell line by U2AF1L4 polyclonal antibody. Lane 1: U2AF1L3 transfected lysate(22.22 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: U2AF1L4 Antibody [H00199746-B01P] - Analysis of purified antibody to U2AF1L3 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

U2AF1L4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse U2AF1L4 Antibody - Azide and BSA Free (H00199746-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: U2AF1L4 (AAH21186.1, 1 a.a. - 202 a.a.) full-length human protein. MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEMNVCDNLGDHVVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSIM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: U2AF1L4
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Immunofluorescence

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for U2AF1L4 Antibody - Azide and BSA Free

• FLJ35525
• MGC33901
• splicing factor U2AF 26 kDa subunit
• U2 auxiliary factor 26
• U2 small nuclear RNA auxiliary factor 1-like 3
• U2 small nuclear RNA auxiliary factor 1-like 4
• U2 small nuclear RNA auxiliary factor 1-like protein 3
• U2 small nuclear RNA auxiliary factor 1-like protein 4
• U2(RNU2) small nuclear RNA auxiliary factor 1-like 3
• U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3
• U2AF1L3
• U2AF1L3V1
• U2AF1-like protein 3
• U2AF1RS3
• U2AF1-RS3
• U2af26

Background

RNA-binding protein that function as a pre-mRNA splicing factor. Plays a critical role in both constitutiveand enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required foraccurate 3'-splice site selection. Acts by enhancing the binding of U2AF2 to weak pyrimidine tracts. Also participatesin the regulation of alternative pre-mRNA splicing. Activates exon 5 skipping of PTPRC during T cell activation; anevent reversed by GFI1. Binds to RNA at the AG dinucleotide at the 3'-splice site

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: U2AF1L4
• Uniprot:
  • AAH21186.1(Human)