ZPBP2 Antibody

Images

 
Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP2-33671] - Staining of human testis shows high expression.
Immunohistochemistry: ZPBP2 Antibody [NBP2-33671] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry: ZPBP2 Antibody [NBP2-33671] - Staining of liver.
Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP2-33671] - Staining of testis cancer.
Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP2-33671] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP2-33671] - Staining in human testis and endometrium tissues using anti-ZPBP2 antibody. Corresponding ZPBP2 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZPBP2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQ
Specificity
Specificity of human ZPBP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZPBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZPBP2 Protein (NBP2-33671PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZPBP2 Antibody

  • CAAX prenyl protease 1 homolog
  • EC 3.4.24.84
  • FACE1FLJ14968
  • FACE-1zinc metalloproteinase (STE24 homolog, yeast)
  • Farnesylated proteins-converting enzyme 1
  • farnesylated-proteins converting enzyme 1
  • HGPS
  • Hutchinson-Gilford progeria syndrome
  • MADB
  • Prenyl protein-specific endoprotease 1
  • PRO1
  • Ste24p
  • STE24zinc metallopeptidase (STE24 homolog, yeast)
  • zinc metallopeptidase (STE24 homolog, S. cerevisiae)
  • Zinc metalloproteinase Ste24 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33648
Species: Hu
Applications: IHC, IHC-P
H00094103-P01
Species: Hu
NBP2-24495
Species: Hu, Pm
Applications: WB, ICC/IF
NBP2-31726
Species: Hu
Applications: IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-83813
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP2-48564
Species: Hu
Applications: IHC, IHC-P
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-97505
Species: Hu, Mu, Rt, Po, Bv, Ce, Ca, Dr, GP, Pl, Pm, Rb, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-86823
Species: Hu
Applications: IHC, IHC-P

Publications for ZPBP2 Antibody (NBP2-33671) (0)

There are no publications for ZPBP2 Antibody (NBP2-33671).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZPBP2 Antibody (NBP2-33671) (0)

There are no reviews for ZPBP2 Antibody (NBP2-33671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZPBP2 Antibody (NBP2-33671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZPBP2 Antibody (NBP2-33671)

Discover related pathways, diseases and genes to ZPBP2 Antibody (NBP2-33671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZPBP2 Antibody (NBP2-33671)

Discover more about diseases related to ZPBP2 Antibody (NBP2-33671).
 

Pathways for ZPBP2 Antibody (NBP2-33671)

View related products by pathway.

PTMs for ZPBP2 Antibody (NBP2-33671)

Learn more about PTMs related to ZPBP2 Antibody (NBP2-33671).

Blogs on ZPBP2

There are no specific blogs for ZPBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZPBP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZPBP2
Uniprot