We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ZNRF1 Recombinant Protein Antigen

Images

 
There are currently no images for ZNRF1 Protein (NBP1-84196PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZNRF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNRF1.

Source: E. coli

Amino Acid Sequence: ASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLPIAPRWFSSHSGFKCPICSKSVASDEMEMHFI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZNRF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84196.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZNRF1 Recombinant Protein Antigen

  • DKFZp434E229
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ14846
  • MGC15430
  • nerve injury gene 283
  • Nerve injury-induced gene 283 protein
  • nin283
  • NIN283E3 ubiquitin-protein ligase ZNRF1
  • zinc and ring finger 1
  • zinc and ring finger protein 1
  • Zinc/RING finger protein 1

Background

In a study identifying genes in rat that are upregulated in response to nerve damage, a gene which is highly expressed in ganglia and in the central nervous system was found. The protein encoded by the rat gene contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification. The protein encoded by this human gene is highly similar in sequence to that encoded by the rat gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
NBP1-28715
Species: Hu
Applications: IP, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-92382
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-67766
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-27724
Species: Hu
Applications: ICC/IF, IHC, WB
NBP2-15581
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-76593
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-14886
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87329
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-57183
Species: Hu
Applications: ICC/IF, WB

Publications for ZNRF1 Protein (NBP1-84196PEP) (0)

There are no publications for ZNRF1 Protein (NBP1-84196PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNRF1 Protein (NBP1-84196PEP) (0)

There are no reviews for ZNRF1 Protein (NBP1-84196PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZNRF1 Protein (NBP1-84196PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNRF1 Products

Array NBP1-84196PEP

Research Areas for ZNRF1 Protein (NBP1-84196PEP)

Find related products by research area.

Blogs on ZNRF1

There are no specific blogs for ZNRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZNRF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNRF1