Recombinant Human ZNRF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNRF1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 74 - 178 of Human ZNRF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLT

Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNRF1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNRF1 Protein

  • DKFZp434E229
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ14846
  • MGC15430
  • nerve injury gene 283
  • Nerve injury-induced gene 283 protein
  • nin283
  • NIN283E3 ubiquitin-protein ligase ZNRF1
  • zinc and ring finger 1
  • zinc and ring finger protein 1
  • Zinc/RING finger protein 1

Background

ZNRF1 - zinc and ring finger 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-28715
Species: Hu
Applications: WB, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-92382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34152
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15581
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56357
Species: Hu
Applications: WB, IP
NBP2-14886
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56397
Species: Hu
Applications: WB

Publications for ZNRF1 Partial Recombinant Protein (H00084937-Q01) (0)

There are no publications for ZNRF1 Partial Recombinant Protein (H00084937-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNRF1 Partial Recombinant Protein (H00084937-Q01) (0)

There are no reviews for ZNRF1 Partial Recombinant Protein (H00084937-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNRF1 Partial Recombinant Protein (H00084937-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNRF1 Products

Bioinformatics Tool for ZNRF1 Partial Recombinant Protein (H00084937-Q01)

Discover related pathways, diseases and genes to ZNRF1 Partial Recombinant Protein (H00084937-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNRF1 Partial Recombinant Protein (H00084937-Q01)

Discover more about diseases related to ZNRF1 Partial Recombinant Protein (H00084937-Q01).
 

Pathways for ZNRF1 Partial Recombinant Protein (H00084937-Q01)

View related products by pathway.

PTMs for ZNRF1 Partial Recombinant Protein (H00084937-Q01)

Learn more about PTMs related to ZNRF1 Partial Recombinant Protein (H00084937-Q01).
 

Research Areas for ZNRF1 Partial Recombinant Protein (H00084937-Q01)

Find related products by research area.

Blogs on ZNRF1

There are no specific blogs for ZNRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNRF1 Antibody
NBP1-84196

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNRF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNRF1