ZNF750 Recombinant Protein Antigen

Images

 
There are currently no images for ZNF750 Protein (NBP1-82246PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZNF750 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF750.

Source: E.coli

Amino Acid Sequence: PKQTNQPDATAKPASSKSVANGLSAFDSKLQHSSAREDIKENLELQARGTHRCLGQKPALHRASPCKSPAPEAALGAQPALEGAARPSAFVPVGEHRLKGPDNAEAPETLALHNP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZNF750
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82246.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ZNF750 Recombinant Protein Antigen

  • FLJ13841
  • FLJ51362
  • MGC125667
  • MGC125668
  • protein ZNF750
  • ZFP750
  • zinc finger protein 750

Background

The ZNF750 gene encodes a protein with a nuclear localization site and a C2H2 zinc finger domain. Mutations in this gene havebeen associated with seborrhea-like dermatitis with psoriasiform elements. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85571
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-87528
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33610
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
AF3158
Species: Mu
Applications: ChIP, ICC, IHC, WB
NBP1-90510
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-92873
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37368
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IMC, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB4866
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-32533
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-97503
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
NBP2-57087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75468
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-93582
Species: Hu, Mu, Rt
Applications: WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, In vivo, Simple Western, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB

Publications for ZNF750 Protein (NBP1-82246PEP) (0)

There are no publications for ZNF750 Protein (NBP1-82246PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF750 Protein (NBP1-82246PEP) (0)

There are no reviews for ZNF750 Protein (NBP1-82246PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZNF750 Protein (NBP1-82246PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF750 Products

Bioinformatics Tool for ZNF750 Protein (NBP1-82246PEP)

Discover related pathways, diseases and genes to ZNF750 Protein (NBP1-82246PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF750 Protein (NBP1-82246PEP)

Discover more about diseases related to ZNF750 Protein (NBP1-82246PEP).
 

Pathways for ZNF750 Protein (NBP1-82246PEP)

View related products by pathway.

Blogs on ZNF750

There are no specific blogs for ZNF750, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZNF750 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF750