Home » ZNF750 » ZNF750 Proteins » ZNF750 Recombinant Protein Antigen

ZNF750 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ZNF750 Protein (NBP1-82246PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ZNF750 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF750.

Source: E.coli

Amino Acid Sequence: PKQTNQPDATAKPASSKSVANGLSAFDSKLQHSSAREDIKENLELQARGTHRCLGQKPALHRASPCKSPAPEAALGAQPALEGAARPSAFVPVGEHRLKGPDNAEAPETLALHNP
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZNF750
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82246.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ZNF750 Recombinant Protein Antigen

  • FLJ13841
  • FLJ51362
  • MGC125667
  • MGC125668
  • protein ZNF750
  • ZFP750
  • zinc finger protein 750

Background

The ZNF750 gene encodes a protein with a nuclear localization site and a C2H2 zinc finger domain. Mutations in this gene havebeen associated with seborrhea-like dermatitis with psoriasiform elements. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CKAP4/p63 Antibody
NBP1-85571
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine shows high expression.
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining in human cervix, uterine and skeletal muscle tissues using anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow, cerebral cortex, cervix, uterine and skeletal muscle using Anti-CKAP4 antibody NBP1-85571 (A) shows similar protein distribution across tissues to independent antibody NBP1-85572 (B).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(9 Publications)
Species: Hu
Applications: ICC, IHC, WB
FGFR1 Antibody
(M19B2) - BSA Free
NB600-1287
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis using the Alexa Fluor 488 (R) conjugate of NB600-1287. Staining of FGF R1 in HEK293 and HEK293 FGFR transfected cells using anti-FGF R1 antibody. (Red) Positive cells, (Green) Negative cells, (Blue) Negative cells + antibody, (Pink) Positive cells + antibody. Image from verified customer review.
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Intracellular flow cytometric staining of 1 x 10^6 HEK-293 cells using FGF R1 antibody (Dark Blue) and Isotype control (Orange). An antibody concentration of 1 ug/1x10^6 cells was used.
Western Blot: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis of MCF7 (A), HepG2 (B), NIH3T3 (C), and PC-12 (D) cell lysate using FGF R1 antibody at 2 ug/ml.
(1 Review)
(7 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Filaggrin Antibody
NBP1-87528
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Analysis in human skin and liver tissues. Corresponding Filaggrin RNA-seq data are presented for the same tissues.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Loricrin Antibody
NBP1-33610
Simple Western: Loricrin Antibody [NBP1-33610] - NHEK human normal epidermal keratinocytes. Antibody dilution of 1:50. Protein concentration of 450 ug/mL. Detection is chemiluminescence. Simple Western image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Loricrin Antibody [NBP1-33610] - Reconstructed human epidermis tissues were embedded in paraffin. After successives baths in xylene and ethanol, antigen was retrieved using warm citrate (for 30 min). Specimens were incubated overnight with the primary antibody (1:100 dilution). Blue staining corresponds to nuclei while loricrin is visible in green. IHC-P image submitted by a verified customer review.
Immunohistochemistry: Loricrin Antibody [NBP1-33610] - Prominent differences in the expressions of innate immune and barrier molecules between sebaceous gland poor (SGR) and sebaceous gland rich (SGP) skin regions. Representative images for immunostaining and quantification of epidermal levels of LOR in SGP and SGR skin sections. Images of negative control stainings are shown in the bottom left corner of SGP immunostainings. Size bars=100um. The graphs show the mean +/- SEM of measured protein levels (*p<0.05; **p<0.01; ***p<0.001, as determined by Mann-Whitney U-test). Image collected and cropped by CiteAb from the following publication (frontiersin.org/articles/10.3389/fimmu.2018.00424/full), licensed under a CC-BY licence.
(3 Reviews)
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
KLF4 Antibody
[Unconjugated]
AF3158
D3 mouse embryonic stem cell line was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. KLF4/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Mouse KLF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3158) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The B2R promoter was detected by standard PCR.
KLF4 was detected in immersion fixed D3 mouse embryonic stem cell line using Mouse KLF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3158) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
KLF4 was detected in perfusion fixed frozen sections of mouse colon tissue using Goat Anti-Mouse KLF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3158) at 1 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (brown; Catalog # VC004) and counterstained with hematoxylin (blue). Specific staining was localized to cell nuclei. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(2 Reviews)
(44 Publications)
Species: Mu
Applications: ChIP, ICC, IHC, WB
SPINK5 Antibody
NBP1-90510
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Analysis in human tonsil and kidney tissues using Anti-SPINK5 antibody. Corresponding SPINK5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Staining of human tonsil shows high expression.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CARD14 Antibody
NBP2-92873
Western Blot: CARD14 Antibody [NBP2-92873] - Analysis of extracts of various cell lines, using CARD14 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CD7 Antibody
(5B10E3) - BSA Free
NBP2-37368
Imaging Mass Cytometry: CD7 Antibody (5B10E3) [NBP2-37368] - FFPE human tonsil tissue, CD7 conjugated to 173Yb. IMC image submitted by a verified customer review.
ELISA: CD7 Antibody (5B10E3) [NBP2-37368] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: CD7 Antibody (5B10E3) [NBP2-37368] - Western blot analysis using CD7 mAb against human CD7 recombinant protein. (Expected MW is 36.6 kDa)
(1 Review)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IMC, IHC, IHC-P, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
(9 Reviews)
(41 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

AATK/Serine/threonine- ...
MAB4866
A172 human glioblastoma cell line was stained with Mouse Anti-Human AATK Monoclonal Antibody (Catalog # MAB4866, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgGF(ab')2 Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: CyTOF-ready, ICFlow
ALOXE3 Antibody
NBP1-32533
Immunohistochemistry-Paraffin: ALOXE3 Antibody [NBP1-32533] - NCI-N87 xenograft, using ALOXE3 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Western Blot: ALOXE3 Antibody [NBP1-32533] - Sample(30 ug whole cell lysate)A:Hep G2 7. 5% SDS PAGE, antibody diluted at 1:1000.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
HOP Antibody
(DS14F5)
NBP1-97503
HOP Antibody (DS14F5)
(6 Publications)
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
GRHL3 Antibody
NBP2-57087
Immunocytochemistry/Immunofluorescence: GRHL3 Antibody [NBP2-57087] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Analysis in human urinary bladder and skeletal muscle tissues. Corresponding GRHL3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Desmoglein-1
Antibody (JB19-46)
NBP2-75468
Immunohistochemistry-Paraffin: Desmoglein-1 Antibody (JB19-46) [NBP2-75468] - Analysis of paraffin-embedded human colon cancer tissue using anti-DSG1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Desmoglein-1 Antibody (JB19-46) [NBP2-75468] - Analysis of paraffin-embedded human skin tissue using anti-DSG1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Desmoglein-1 Antibody (JB19-46) [NBP2-75468] - Analysis of paraffin-embedded human uterus tissue using anti-DSG1 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ZNF673 Antibody
NBP2-93582
Western Blot: ZNF673 Antibody [NBP2-93582] - Analysis of extracts of various cell lines, using ZNF673 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.
Species: Hu, Mu, Rt
Applications: WB
RPE65 Antibody
(401.8B11.3D9) - BSA ...
NB100-355
Immunohistochemistry: RPE65 Antibody (401.8B11.3D9) [NB100-355] - Zebrafish brain ventricular area labeled with mouse anti-RPE65 (1:100). This image was submitted through a verified customer review.
Immunohistochemistry-Paraffin: RPE65 Antibody (401.8B11.3D9) [NB100-355] - Analysis of FFPE human glioblastoma tissue section using 1:500 dilution of RPE65 [401.8B11.3D9] antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems).
Western Blot: RPE65 Antibody (401.8B11.3D9) [NB100-355] - Subcellular localization of BEST1 and surface Ca2+-dependent Cl- current in patient-derived iPSC-RPEs. Western blots show similar BEST1 expression levels in WT and patient-derived iPSC-RPEs. Each sample was from one cell lysis (BEST1 and beta-actin, RPE65 and CRALBP were on two gels, respectively). Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/29914), licensed under a CC-BY licence.
(7 Reviews)
(84 Publications)
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, In vivo, Simple Western, WB
UVRAG Antibody
NBP1-18885
Immunohistochemistry-Paraffin: UVRAG Antibody [NBP1-18885] - Section of human colon carcinoma. Antibody: Affinity purified rabbit anti- UVRAG used at a dilution of 1:200 (1ug/ml). Detection: DAB
Western Blot: UVRAG Antibody [NBP1-18885] - Beclin 1 is acetylated at lysines 430 and 437. Mutations of K430 and K437 decrease the binding of Beclin 1 and Rubicon. Immunoprecipitation of indicated proteins with Beclin 1 in HEK293T cells transfected with indicated Beclin 1 constructs. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms8215), licensed under a CC-BY licence.
Western Blot: UVRAG Antibody [NBP1-18885] - Beclin 1 is acetylated at lysines 430 and 437. TSA and NAM increase the binding of Beclin 1 to Rubicon. Immunoprecipitation of indicated Beclin 1-binding partners with ectopically expressed Flag-Beclin 1 in HEK293T cells treated with TSA and NAM. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms8215), licensed under a CC-BY licence.
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB

Publications for ZNF750 Protein (NBP1-82246PEP) (0)

There are no publications for ZNF750 Protein (NBP1-82246PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF750 Protein (NBP1-82246PEP) (0)

There are no reviews for ZNF750 Protein (NBP1-82246PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZNF750 Protein (NBP1-82246PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF750 Products

Bioinformatics Tool for ZNF750 Protein (NBP1-82246PEP)

Discover related pathways, diseases and genes to ZNF750 Protein (NBP1-82246PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF750 Protein (NBP1-82246PEP)

Discover more about diseases related to ZNF750 Protein (NBP1-82246PEP).
 

Pathways for ZNF750 Protein (NBP1-82246PEP)

View related products by pathway.

Blogs on ZNF750

There are no specific blogs for ZNF750, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunohistochemistry: RPE65 Antibody (401.8B11.3D9) [NB100-355] - Zebrafish brain ventricular area labeled with mouse anti-RPE65 (1:100). This image was submitted through a verified customer review.
RPE65 Antibody (401.8B11.3D9) - BSA Free
NB100-355
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
CD4 Antibody - BSA Free
NBP1-19371

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZNF750 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ZNF750