ZNF674 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF674 Antibody [NBP2-55718] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF674 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VDEQIDHYKESQDKLPWQAAFIGKETLKDESGQ
Specificity
Specificity of human ZNF674 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF674
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF674 Recombinant Protein Antigen (NBP2-55718PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZNF674 Antibody

  • MRX92
  • zinc finger protein 674

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56852
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79990
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-94028
Species: Hu, Mu
Applications: WB, IHC
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NB600-1101
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13347
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-68766
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF5158
Species: Hu
Applications: WB, IHC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-55223
Species: Hu
Applications: IHC, IHC-P
NBP2-15897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ZNF674 Antibody (NBP2-55718) (0)

There are no publications for ZNF674 Antibody (NBP2-55718).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF674 Antibody (NBP2-55718) (0)

There are no reviews for ZNF674 Antibody (NBP2-55718). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF674 Antibody (NBP2-55718) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF674 Products

Bioinformatics Tool for ZNF674 Antibody (NBP2-55718)

Discover related pathways, diseases and genes to ZNF674 Antibody (NBP2-55718). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF674 Antibody (NBP2-55718)

Discover more about diseases related to ZNF674 Antibody (NBP2-55718).

Blogs on ZNF674

There are no specific blogs for ZNF674, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF674 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF674