ZNF655 Antibody - BSA Free

Western Blot: ZNF655 Antibody [NBP1-80625] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-663

Immunocytochemistry/Immunofluorescence: ZNF655 Antibody [NBP1-80625] - Staining of human cell line A-431 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ZNF655 Antibody [NBP1-80625] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: ZNF655 Antibody [NBP1-80625] - Staining of human esophagus shows nuclear and cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: ZNF655 Antibody [NBP1-80625] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells and neurons.

Immunohistochemistry-Paraffin: ZNF655 Antibody [NBP1-80625] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: ZNF655 Antibody [NBP1-80625] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF655 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TDDNDKYDMSFNQNSASGKHEHLNLTEDFQSSECKESLMDLSHLNKWESIPNTEKSYKCDVCGKIFHQSSALTRHQRI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF655
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF655 Protein (NBP1-80625PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF655 Antibody - BSA Free

• zinc finger protein 655

Background

The ZNF655 gene encodes a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-proteininteractions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for thisgene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF655 Antibody (NBP1-80625)(2)

Publications using NBP1-80625

• Yeudall S, Upchurch CM, Seegren PV et al. Macrophage acetyl-CoA carboxylase regulates acute inflammation through control of glucose and lipid metabolism Science advances 2022-11-25 [PMID: 36417534] (WB, Mouse)
  
  Details:
  Dilution of 1:1000 was used
• Yao M, Tijore A, Cheng D et al. Force- and cell state-dependent recruitment of Piezo1 drives focal adhesion dynamics and calcium entry Science advances 2022-11-11 [PMID: 36351022] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: ZNF655
• Entrez:
  • 79027(Human)