We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ZNF638 Recombinant Protein Antigen

Images

 
There are currently no images for ZNF638 Recombinant Protein Antigen (NBP2-56119PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZNF638 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF638.

Source: E. coli

Amino Acid Sequence: EPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQERIPHEPVINSSNVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZNF638
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56119.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZNF638 Recombinant Protein Antigen

  • CTCL tumor antigen se33-1
  • CTCL-associated antigen se33-1
  • Cutaneous T-cell lymphoma-associated antigen se33-1
  • DKFZp686P1231
  • MGC26130
  • MGC90196
  • NP220 nuclear protein
  • NP220zinc finger, matrin-like
  • Nuclear protein 220
  • ZFML
  • Zfp638
  • Zinc finger matrin-like protein
  • zinc finger protein 638

Background

ZNF638 is encoded by this gene is a nucleoplasmic protein. It binds cytidine-rich sequences in double-stranded DNA. This protein has three types of domains: MH1, MH2 (repeated three times) and MH3. It is associated with packaging, transferring, or processing transcripts. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1761
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP3-46699
Species: Hu, Mu
Applications: ELISA, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-74624
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-31209
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KO, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89549
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00010781-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-13236
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80833
Species: Hu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP1-85699
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84978
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for ZNF638 Recombinant Protein Antigen (NBP2-56119PEP) (0)

There are no publications for ZNF638 Recombinant Protein Antigen (NBP2-56119PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF638 Recombinant Protein Antigen (NBP2-56119PEP) (0)

There are no reviews for ZNF638 Recombinant Protein Antigen (NBP2-56119PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZNF638 Recombinant Protein Antigen (NBP2-56119PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF638 Products

Array NBP2-56119PEP

Blogs on ZNF638

There are no specific blogs for ZNF638, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF638 Antibody
NB100-77291

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZNF638 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF638