ZNF618 Antibody


Western Blot: ZNF618 Antibody [NBP2-57450] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: ZNF618 Antibody [NBP2-57450] - Staining of human cell line A549 shows localization to nucleoplasm.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

ZNF618 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CFQEHRDLHAVDVFSVEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVALHAPISTAPGWEPPDDPDTGSECS
Specificity of human ZNF618 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF618 Recombinant Protein Antigen (NBP2-57450PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ZNF618 Antibody

  • developmentally down-regulated 10
  • KIAA1952
  • zinc finger protein 618


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, B/N
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, ELISA, IB, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF618 Antibody (NBP2-57450) (0)

There are no publications for ZNF618 Antibody (NBP2-57450).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF618 Antibody (NBP2-57450) (0)

There are no reviews for ZNF618 Antibody (NBP2-57450). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF618 Antibody (NBP2-57450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ZNF618 Products

Bioinformatics Tool for ZNF618 Antibody (NBP2-57450)

Discover related pathways, diseases and genes to ZNF618 Antibody (NBP2-57450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF618 Antibody (NBP2-57450)

Discover more about diseases related to ZNF618 Antibody (NBP2-57450).

Blogs on ZNF618

There are no specific blogs for ZNF618, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF618 Antibody and receive a gift card or discount.


Gene Symbol ZNF618