![Immunohistochemistry-Paraffin: ZNF618 Antibody [NBP1-92635] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize2/ZNF618-Antibody-Immunohistochemistry-Paraffin-NBP1-92635-img0007.jpg "Immunohistochemistry-Paraffin: ZNF618 Antibody [NBP1-92635] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VIELSNESQPTLQLVLPTYVRLEKLFTAKANDAGTVSKLCHLFLEALKENFKVHPAHKVAMILDPQQKLRPVPPYQHEEIIGKVCELINEVKESWAEEA |
| Predicted Species | Mouse (99%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF618 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-Paraffin-NB100-56565-img0014.jpg)
-Western-Blot-NB100-56565-img0015.jpg)
-Western-Blot-NB100-56565-img0017.jpg)
---BSA-Free-Western-Blot-NBP2-80096-img0001.jpg)
---BSA-Free-Immunoprecipitation-NBP2-80096-img0002.jpg)
-Western-Blot-MAB7442-img0001.jpg)
-ELISA-H00121441-M05-img0007.jpg)
-Western-Blot-H00121441-M05-img0001.jpg)
-Western-Blot-H00121441-M05-img0002.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for ZNF618 Antibody (NBP1-92635)Discover more about diseases related to ZNF618 Antibody (NBP1-92635).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF618 |
![Immunohistochemistry-Paraffin: ZNF618 Antibody [NBP1-92635] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize2/ZNF618-Antibody-Immunohistochemistry-Paraffin-NBP1-92635-img0004.jpg "Immunohistochemistry-Paraffin: ZNF618 Antibody [NBP1-92635] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: ZNF618 Antibody [NBP1-92635] - Staining of human cervix shows strong cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize2/ZNF618-Antibody-Immunohistochemistry-Paraffin-NBP1-92635-img0005.jpg "Immunohistochemistry-Paraffin: ZNF618 Antibody [NBP1-92635] - Staining of human cervix shows strong cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: ZNF618 Antibody [NBP1-92635] - Staining of human kidney shows moderate nuclear and cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/ZNF618-Antibody-Immunohistochemistry-Paraffin-NBP1-92635-img0006.jpg "Immunohistochemistry-Paraffin: ZNF618 Antibody [NBP1-92635] - Staining of human kidney shows moderate nuclear and cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry CD30 Ligand/TNFSF8 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD30_Ligand_AF1028_Immunohistochemistry_20252.jpg)
![Immunohistochemistry CD30 Ligand/TNFSF8 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD30_Ligand_AF1028_Immunohistochemistry_20253.jpg)
![Flow Cytometry CD30 Ligand/TNFSF8 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1028_human-cd30-ligand-tnfsf8-affinity-purified-polyclonal-ab-flow-cytometry-286202212274.jpg)
![alpha 1-Acid Glycoprotein [HRP]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_DAGP00_ELISA_26.jpg)
![alpha 1-Acid Glycoprotein [HRP]](https://images.novusbio.com/images2/DATA_alpha_1Acid_Glycoprotein_DAGP00_ELISA_568.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")