ZNF274 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZNF274 Antibody [NBP3-10523] - Immunohistochemical analysis of paraffin-embedded human lung tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZNF274 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF274 Antibody - BSA Free (NBP3-10523) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF274 (NP_057408). Peptide sequence SHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF274
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 62 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZNF274 Antibody - BSA Free

• GIOT2
• GIOT-2
• gonadotropin inducible transcription repressor-2
• Gonadotropin-inducible ovary transcription repressor 2
• gonadotropin-inducible transcription repressor 2
• KOX7DKFZp434F1811
• zinc finger protein 44 (KOX 7)
• zinc finger protein 44
• Zinc finger protein 55DKFZp686L21136
• Zinc finger protein 58ZNF504
• Zinc finger protein KOX7
• zinc finger protein ZnFP12
• ZNF
• ZNF55
• ZNF58

Background

ZNF274 encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF274