Recombinant Human ZNF239 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZNF239 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human ZNF239

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTLQSGCFENIESETYLPLKVSSQIDTQDSSVKFCKNEPQDHQESRRLFVMEE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF239
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF239 GST (N-Term) Protein

  • KIAA1198
  • zinc finger protein 490

Background

MOK2 proteins are DNA- and RNA-binding proteins that are mainly associated with nuclear RNP components, including the nucleoli and extranucleolar structures (Arranz et al., 1997 [PubMed 9121460]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93946
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-25151
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
NB100-88153
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP2-67800
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
NBP2-80461
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF1205
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NBP2-67618
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
AF5596
Species: Hu
Applications: ICC, IHC, WB

Publications for ZNF239 Partial Recombinant Protein (H00008187-Q01) (0)

There are no publications for ZNF239 Partial Recombinant Protein (H00008187-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF239 Partial Recombinant Protein (H00008187-Q01) (0)

There are no reviews for ZNF239 Partial Recombinant Protein (H00008187-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF239 Partial Recombinant Protein (H00008187-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF239 Products

Bioinformatics Tool for ZNF239 Partial Recombinant Protein (H00008187-Q01)

Discover related pathways, diseases and genes to ZNF239 Partial Recombinant Protein (H00008187-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF239 Partial Recombinant Protein (H00008187-Q01)

Discover more about diseases related to ZNF239 Partial Recombinant Protein (H00008187-Q01).
 

Pathways for ZNF239 Partial Recombinant Protein (H00008187-Q01)

View related products by pathway.

PTMs for ZNF239 Partial Recombinant Protein (H00008187-Q01)

Learn more about PTMs related to ZNF239 Partial Recombinant Protein (H00008187-Q01).

Blogs on ZNF239

There are no specific blogs for ZNF239, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF239 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF239