We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ZNF198 Recombinant Protein Antigen

Images

 
There are currently no images for ZNF198 Protein (NBP1-84685PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZNF198 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZMYM2.

Source: E. coli

Amino Acid Sequence: RLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZMYM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84685.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZNF198 Recombinant Protein Antigen

  • FIMRAMPSCLL
  • Fused in myeloproliferative disorders protein
  • MYM
  • Rearranged in atypical myeloproliferative disorder protein
  • Zinc finger protein 198rearranged in an atypical myeloproliferative disorder
  • zinc finger, MYM-type 2
  • ZNF198zinc finger MYM-type protein 2

Background

Official Gene Symbol: ZMYM2 Gen Bank Accession Number: NP_932072 Gene ID: 7750 (Human) Gene Map Locus: 13q11-q12 (Human) ZNF198 is a ubiquitously expressed nuclear protein whose physiological role is largely unknown. It consists of 5 N-terminal zinc finger motifs responsible for protein-protein interactions, a central proline-rich domain and C-terminal nuclear localization signal (NLS) and an acidic domain. Reciprocal chromosomal translocation involving ZNF198 and FGFR1 results in the formation of ZNF198/FGFR1 fusion kinase protein. This fusion protein is a ligand-dependent, constitutively active cytoplasmic tyrosine kinase and regulates several STAT transcription factors including STAT 1, 3 and 5. This fusion protein is an oncogenic protein and is associated with an atypical myeloproliferative disease, peripheral blood eosinophilia and T-cell leukemia/lymphoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS6731
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC,  IHC-P
NBP2-94078
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-01853
Species: Hu, Pm
Applications: Flow, IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-27994
Species: Hu
Applications: ELISA, Flow, Func
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
664-LI
Species: Hu
Applications: BA
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-77086
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-87784
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for ZNF198 Protein (NBP1-84685PEP) (0)

There are no publications for ZNF198 Protein (NBP1-84685PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF198 Protein (NBP1-84685PEP) (0)

There are no reviews for ZNF198 Protein (NBP1-84685PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZNF198 Protein (NBP1-84685PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF198 Products

Array NBP1-84685PEP

Blogs on ZNF198

There are no specific blogs for ZNF198, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZNF198 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMYM2