Recombinant Human ZNF198 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZNF198 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 971-1069 of Human ZNF198

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SVIIETDIIGSDLLKNSDPETQSSMPDVPYEPDLDIEIDFPRAAEELDMENEFLLPPVFGEEYEEQPRPRSKKKGAKRKAVSGYQSHDDSSDNSECSFP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZMYM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF198 GST (N-Term) Protein

  • FIMRAMPSCLL
  • Fused in myeloproliferative disorders protein
  • MYM
  • Rearranged in atypical myeloproliferative disorder protein
  • Zinc finger protein 198rearranged in an atypical myeloproliferative disorder
  • zinc finger, MYM-type 2
  • ZNF198zinc finger MYM-type protein 2

Background

Official Gene Symbol: ZMYM2 Gen Bank Accession Number: NP_932072 Gene ID: 7750 (Human) Gene Map Locus: 13q11-q12 (Human) ZNF198 is a ubiquitously expressed nuclear protein whose physiological role is largely unknown. It consists of 5 N-terminal zinc finger motifs responsible for protein-protein interactions, a central proline-rich domain and C-terminal nuclear localization signal (NLS) and an acidic domain. Reciprocal chromosomal translocation involving ZNF198 and FGFR1 results in the formation of ZNF198/FGFR1 fusion kinase protein. This fusion protein is a ligand-dependent, constitutively active cytoplasmic tyrosine kinase and regulates several STAT transcription factors including STAT 1, 3 and 5. This fusion protein is an oncogenic protein and is associated with an atypical myeloproliferative disease, peripheral blood eosinophilia and T-cell leukemia/lymphoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS6731
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
AF6428
Species: Hu
Applications: IHC, WB
NBP2-01853
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, WB
AF6108
Species: Hu
Applications: IHC
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
AF4875
Species: Hu
Applications: WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
664-LI/CF
Species: Hu
Applications: BA
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-77086
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-87784
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for ZNF198 Partial Recombinant Protein (H00007750-Q01) (0)

There are no publications for ZNF198 Partial Recombinant Protein (H00007750-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF198 Partial Recombinant Protein (H00007750-Q01) (0)

There are no reviews for ZNF198 Partial Recombinant Protein (H00007750-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF198 Partial Recombinant Protein (H00007750-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF198 Products

Array H00007750-Q01

Bioinformatics Tool for ZNF198 Partial Recombinant Protein (H00007750-Q01)

Discover related pathways, diseases and genes to ZNF198 Partial Recombinant Protein (H00007750-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF198 Partial Recombinant Protein (H00007750-Q01)

Discover more about diseases related to ZNF198 Partial Recombinant Protein (H00007750-Q01).
 

Pathways for ZNF198 Partial Recombinant Protein (H00007750-Q01)

View related products by pathway.

PTMs for ZNF198 Partial Recombinant Protein (H00007750-Q01)

Learn more about PTMs related to ZNF198 Partial Recombinant Protein (H00007750-Q01).

Blogs on ZNF198

There are no specific blogs for ZNF198, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF198 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMYM2