ZNF193 Antibody


Immunocytochemistry/ Immunofluorescence: ZNF193 Antibody [NBP2-31579] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZNF193 Antibody [NBP2-31579] - Staining of human testis shows nuclear positivity in Leydig cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ZNF193 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ELVLRKDCPKIVEPHGKMFNEQTWEVSQQDPSHGEVGEHKDRIERQWGNLLGEGQHKCDE
Specificity of human ZNF193 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF193 Protein (NBP2-31579PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZNF193 Antibody

  • cell proliferation-inducing protein 12
  • PRD51ZSCAN9Cell proliferation-inducing gene 12 protein
  • Zinc finger and SCAN domain-containing protein 9
  • zinc finger protein 193


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for ZNF193 Antibody (NBP2-31579) (0)

There are no publications for ZNF193 Antibody (NBP2-31579).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF193 Antibody (NBP2-31579) (0)

There are no reviews for ZNF193 Antibody (NBP2-31579). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF193 Antibody (NBP2-31579) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF193 Products

Bioinformatics Tool for ZNF193 Antibody (NBP2-31579)

Discover related pathways, diseases and genes to ZNF193 Antibody (NBP2-31579). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF193 Antibody (NBP2-31579)

Discover more about diseases related to ZNF193 Antibody (NBP2-31579).

Blogs on ZNF193

There are no specific blogs for ZNF193, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF193 Antibody and receive a gift card or discount.


Gene Symbol ZNF193