ZNF193 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZNF193 Antibody [NBP2-31579] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: ZNF193 Antibody [NBP2-31579] - Staining of human testis shows nuclear positivity in Leydig cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF193 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELVLRKDCPKIVEPHGKMFNEQTWEVSQQDPSHGEVGEHKDRIERQWGNLLGEGQHKCDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF193
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF193 Protein (NBP2-31579PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNF193 Antibody - BSA Free

• cell proliferation-inducing protein 12
• PRD51ZSCAN9Cell proliferation-inducing gene 12 protein
• Zinc finger and SCAN domain-containing protein 9
• zinc finger protein 193

Background

ZNF193 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF193
• Uniprot:
  • O15535(Human)