ZHX2 Antibody

Images

 
Immunohistochemistry-Paraffin: ZHX2 Antibody [NBP1-82955] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZHX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KYDSLSDHNSKFHPGEANFKLKLIKRNNQTVLEQSIETTNHVVSITTSGPGTGDSDSGISVSKTPIMKPGKPKADAKKVPKKPEEITPENHVEGTARLVTDTAEILSRLGGVELLQDTLGHVMPSVQLPPNINLVPKVPVPLNTTKYNSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZHX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZHX2 Protein (NBP1-82955PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZHX2 Antibody

  • zona pellucida glycoprotein 2 (sperm receptor)
  • Zona pellucida glycoprotein 2
  • zona pellucida glycoprotein ZP2
  • Zona pellucida protein A
  • zona pellucida sperm-binding protein 2
  • Zp-2
  • ZPA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-46403
Species: Hu
Applications: IHC
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-43792
Species: Hu
Applications: WB
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC

Publications for ZHX2 Antibody (NBP1-82955) (0)

There are no publications for ZHX2 Antibody (NBP1-82955).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZHX2 Antibody (NBP1-82955) (0)

There are no reviews for ZHX2 Antibody (NBP1-82955). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZHX2 Antibody (NBP1-82955) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZHX2 Products

Bioinformatics Tool for ZHX2 Antibody (NBP1-82955)

Discover related pathways, diseases and genes to ZHX2 Antibody (NBP1-82955). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZHX2 Antibody (NBP1-82955)

Discover more about diseases related to ZHX2 Antibody (NBP1-82955).
 

Pathways for ZHX2 Antibody (NBP1-82955)

View related products by pathway.

PTMs for ZHX2 Antibody (NBP1-82955)

Learn more about PTMs related to ZHX2 Antibody (NBP1-82955).

Blogs on ZHX2

There are no specific blogs for ZHX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZHX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZHX2