ZFP200 Antibody

Images

 
Western Blot: ZFP200 Antibody [NBP1-87460] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-650
Immunocytochemistry/ Immunofluorescence: ZFP200 Antibody [NBP1-87460] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ZFP200 Antibody [NBP1-87460] - Staining of human testis shows cytoplasmic positivity in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFP200 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETLVIMKDVSSSLQNRVHPRPLVKLLPKGVQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF200
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZFP200 Protein (NBP1-87460PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZFP200 Antibody

  • MGC45293
  • zinc finger protein 200
  • ZNFMF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-80604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBL1-11569
Species: Hu
NBP2-10888
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-45893
Species: Hu
Applications: WB, IHC
NBP1-88509
Species: Hu
Applications: WB, IHC, IHC-P
AF3430
Species: Hu
Applications: WB, ICC
NBP1-71867
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP1-87460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZFP200 Antibody (NBP1-87460) (0)

There are no publications for ZFP200 Antibody (NBP1-87460).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP200 Antibody (NBP1-87460) (0)

There are no reviews for ZFP200 Antibody (NBP1-87460). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZFP200 Antibody (NBP1-87460) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFP200 Products

Bioinformatics Tool for ZFP200 Antibody (NBP1-87460)

Discover related pathways, diseases and genes to ZFP200 Antibody (NBP1-87460). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP200 Antibody (NBP1-87460)

Discover more about diseases related to ZFP200 Antibody (NBP1-87460).

Blogs on ZFP200

There are no specific blogs for ZFP200, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFP200 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF200