![Sandwich ELISA: ZFHX4 Antibody (2B12) [H00079776-M11] - Detection limit for recombinant GST tagged ZFHX4 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ZFHX4-Antibody-2B12-Sandwich-ELISA-H00079776-M11-img0001.jpg "Sandwich ELISA: ZFHX4 Antibody (2B12) [H00079776-M11] - Detection limit for recombinant GST tagged ZFHX4 is 1 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2B12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse ZFHX4 Antibody (2B12) - Azide and BSA Free (H00079776-M11) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | ZFHX4 (NP_078997, 2 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ |
| Specificity | ZFHX4 - zinc finger homeodomain 4 (2B12) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ZFHX4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry ATBF1/ZFHX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/ATBF1_AF7384_Immunocytochemistry_12134.jpg)
![Binding Activity IFN-beta [Unconjugated]](https://images.novusbio.com/images2/IFNbeta_8499IF_1038.jpg)
![Simple Western Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/16390.jpg)
![Western Blot Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/Cytokeratin_18_MAB7619_Western_Blot_12720.jpg)
![Immunocytochemistry Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/Cytokeratin_18_MAB7619_Immunocytochemistry_12734.jpg)
