ZDHHC4 Antibody

Images

 
Western Blot: ZDHHC4 Antibody [NBP2-86412] - Host: Rabbit. Target Name: ZDHHC4. Sample Tissue: Rat Muscle lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDHHC4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of rat ZDHHC4. Peptide sequence: LAFPRIIFLLGFVIVLSLLLAGYLCFALYLAATNQTTNEWYRGDWAWCQH The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZDHHC4 Antibody

  • DHHC domain containing 4
  • DHHC-4
  • EC 2.3.1
  • EC 2.3.1.-
  • Zinc finger protein 374
  • zinc finger, DHHC-type containing 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56261
Species: Hu
Applications: ICC/IF, WB
NBP1-59769
Species: Hu
Applications: WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-66995
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1774
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NBP3-03633
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00004499-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00004496-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBL1-13348
Species: Hu
Applications: WB
NBP2-10437
Species: Hu
Applications: WB
NBP1-97493
Species: Eq, Fi, Hu, Mu, Rb, Rt
Applications: EIA, IHC, IHC-P, WB
H00004494-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00004495-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-87740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-86412
Species: Rt
Applications: WB

Publications for ZDHHC4 Antibody (NBP2-86412) (0)

There are no publications for ZDHHC4 Antibody (NBP2-86412).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC4 Antibody (NBP2-86412) (0)

There are no reviews for ZDHHC4 Antibody (NBP2-86412). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZDHHC4 Antibody (NBP2-86412) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZDHHC4 Products

Bioinformatics Tool for ZDHHC4 Antibody (NBP2-86412)

Discover related pathways, diseases and genes to ZDHHC4 Antibody (NBP2-86412). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZDHHC4

There are no specific blogs for ZDHHC4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC4