ZDHHC21 Antibody Blocking Peptide

Product Discontinued

ZDHHC21 Antibody Blocking Peptide Summary

• Description: A human ZDHHC21 antibody blocking peptide.

  Source: Synthetic

  Amino Acid Sequence: (Accession #: NP_848661)ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV
  
  For longer periods of storage, aliquot and store at -20C. Avoid repeat freeze-thaw cycles.

• Source: Synthetic
• Protein/Peptide Type: Antibody Blocking Peptide
• Gene: ZDHHC21
• Purity: N/A

Applications/Dilutions

• Dilutions:
  • Antibody Competition
  • Western Blot
• Application Notes: This peptide is useful as a blocking peptide for NBP1-57049. This synthetic peptide is designed for use in an antibody competition assay with its corresponding antibody. Use of this product in any other assay has not yet been tested. For further blocking peptide related protocol, click here.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: Lyophilized from sterile distilled water.
• Preservative: No Preservative
• Concentration: LYOPH
• Purity: N/A
• Reconstitution Instructions: Reconstitute with 100 uL of sterile PBS for a final peptide concentration of 1 mg/mL.

Alternate Names for ZDHHC21 Antibody Blocking Peptide

• DHHC-21
• DNZ1
• EC 2.3.1
• EC 2.3.1.-
• HSPC097
• probable palmitoyltransferase ZDHHC21
• Zinc finger DHHC domain-containing protein 21
• zinc finger, DHHC domain containing 21
• zinc finger, DHHC-type containing 21,9130404H11Rik

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ZDHHC21