ZDHHC17 Antibody [Alexa Fluor® 532]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Alexa Fluor 532

ZDHHC17 Antibody [Alexa Fluor® 532] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human ZDHHC17 (NP_056151.2).
  
  Sequence:
  TSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKEFRQKVMLGTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZDHHC17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for ZDHHC17 Antibody [Alexa Fluor® 532]

• DHHC-17
• EC 2.3.1
• EC 2.3.1.-
• HIP14HIP-14
• huntingtin interacting protein 14
• huntingtin interacting protein 3
• Huntingtin interacting protein H
• Huntingtin yeast partner H
• Huntingtin-interacting protein 14
• Huntingtin-interacting protein 3
• Huntingtin-interacting protein H
• HYPHHIP-3
• KIAA0946HIP3
• palmitoyltransferase ZDHHC17
• Putative MAPK-activating protein PM11
• Putative NF-kappa-B-activating protein 205
• Zinc finger DHHC domain-containing protein 17
• zinc finger, DHHC domain containing 17
• zinc finger, DHHC-type containing 17

Background

ZDHHC17 / HIP14 is a neuronal palmitoyl transferase. Palmitoylation is critical for trafficking and function of signaling molecules, neurotransmitter receptors, and synaptic scaffolding proteins in neurons. ZDHHC17 also causes cellular transformation. It has been shown that mRNA encoding ZDHHC17 is up-regulated in a number of types of human tumors, thus ZDHHC17 and other PATs (palmitoyl acyltransferases) are potential targets for new anticancer drugs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZDHHC17