ZDHHC13 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZDHHC13 Antibody [NBP1-83823] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: ZDHHC13 Antibody [NBP1-83823] - Staining of human bronchus shows cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDHHC13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IAYLISKGQSVNMTDVNGQTPLMLSAHKVIGPEPTGFLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAGSSLDIQNVKGETPLDMALQN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZDHHC13 Protein (NBP1-83823PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZDHHC13 Antibody

  • DHHC-13
  • EC 2.3.1
  • EC 2.3.1.-
  • FLJ10852
  • FLJ10941
  • HIP14LHIP14-related protein
  • HIP3RP
  • huntingtin interacting protein HIP3RP
  • Huntingtin-interacting protein 14-related protein
  • Huntingtin-interacting protein HIP3RP
  • MGC64994
  • palmitoyltransferase ZDHHC13
  • probable palmitoyltransferase ZDHHC13
  • Putative MAPK-activating protein PM03
  • Putative NF-kappa-B-activating protein 209
  • Zinc finger DHHC domain-containing protein 13
  • zinc finger, DHHC domain containing 13
  • zinc finger, DHHC-type containing 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81748
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-87770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-91951
Species: Hu
Applications: IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NBP1-81418
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84499
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82014
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31763
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83823
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ZDHHC13 Antibody (NBP1-83823) (0)

There are no publications for ZDHHC13 Antibody (NBP1-83823).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC13 Antibody (NBP1-83823) (0)

There are no reviews for ZDHHC13 Antibody (NBP1-83823). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZDHHC13 Antibody (NBP1-83823) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZDHHC13 Products

Bioinformatics Tool for ZDHHC13 Antibody (NBP1-83823)

Discover related pathways, diseases and genes to ZDHHC13 Antibody (NBP1-83823). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC13 Antibody (NBP1-83823)

Discover more about diseases related to ZDHHC13 Antibody (NBP1-83823).
 

Pathways for ZDHHC13 Antibody (NBP1-83823)

View related products by pathway.

PTMs for ZDHHC13 Antibody (NBP1-83823)

Learn more about PTMs related to ZDHHC13 Antibody (NBP1-83823).

Blogs on ZDHHC13

There are no specific blogs for ZDHHC13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC13