ZDHHC12 Antibody


Immunocytochemistry/ Immunofluorescence: ZDHHC12 Antibody [NBP2-31763] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZDHHC12 Antibody [NBP2-31763] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ZDHHC12 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRY
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZDHHC12 Protein (NBP2-31763PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZDHHC12 Antibody

  • EC 2.3.1.-
  • MGC13153
  • MGC54050
  • zinc finger, DHHC-type containing 12
  • ZNF400DHHC domain containing 12


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZDHHC12 Antibody (NBP2-31763) (0)

There are no publications for ZDHHC12 Antibody (NBP2-31763).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC12 Antibody (NBP2-31763) (0)

There are no reviews for ZDHHC12 Antibody (NBP2-31763). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZDHHC12 Antibody (NBP2-31763) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZDHHC12 Products

Bioinformatics Tool for ZDHHC12 Antibody (NBP2-31763)

Discover related pathways, diseases and genes to ZDHHC12 Antibody (NBP2-31763). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC12 Antibody (NBP2-31763)

Discover more about diseases related to ZDHHC12 Antibody (NBP2-31763).

Pathways for ZDHHC12 Antibody (NBP2-31763)

View related products by pathway.

PTMs for ZDHHC12 Antibody (NBP2-31763)

Learn more about PTMs related to ZDHHC12 Antibody (NBP2-31763).

Blogs on ZDHHC12

There are no specific blogs for ZDHHC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZDHHC12 Antibody and receive a gift card or discount.


Gene Symbol ZDHHC12