ZCCHC14 Antibody

Images

 
Western Blot: ZCCHC14 Antibody [NBP1-56777] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZCCHC14 Antibody Summary

Immunogen
Synthetic peptides corresponding to ZCCHC14(zinc finger, CCHC domain containing 14) The peptide sequence was selected from the N terminal of ZCCHC14. Peptide sequence RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZCCHC14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ZCCHC14 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZCCHC14 Antibody

  • BDG29
  • BDG-29
  • KIAA0579
  • MGC126527
  • MGC14139
  • zinc finger CCHC domain-containing protein 14
  • zinc finger, CCHC domain containing 14

Background

ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00002300-D01P
Species: Hu
Applications: WB
AF313
Species: Hu
Applications: WB, Simple Western, IHC, Block
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-19088
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-90167
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3014
Species: Hu
Applications: WB, IHC, Block
NBP2-68838
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77375
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-84850
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2220
Species: Hu, Mu, Rt, Po, Av, Ba, Bv, Ca, SyHa, Pm, Ze
Applications: WB, Simple Western, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KO

Publications for ZCCHC14 Antibody (NBP1-56777) (0)

There are no publications for ZCCHC14 Antibody (NBP1-56777).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZCCHC14 Antibody (NBP1-56777) (0)

There are no reviews for ZCCHC14 Antibody (NBP1-56777). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZCCHC14 Antibody (NBP1-56777) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZCCHC14 Antibody (NBP1-56777)

Discover related pathways, diseases and genes to ZCCHC14 Antibody (NBP1-56777). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZCCHC14 Antibody (NBP1-56777)

Discover more about diseases related to ZCCHC14 Antibody (NBP1-56777).
 

Pathways for ZCCHC14 Antibody (NBP1-56777)

View related products by pathway.

Blogs on ZCCHC14

There are no specific blogs for ZCCHC14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZCCHC14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZCCHC14
Uniprot