C16orf95 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C16orf95 Antibody [NBP1-91131] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: C16orf95 Antibody [NBP1-91131] - Staining of human duodenum shows distinct positivity in enteroendocrine cells.
Immunohistochemistry-Paraffin: C16orf95 Antibody [NBP1-91131] - Staining of human duodenum shows distinct positivity in enteroendocrine cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C16orf95 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS
Specificity
Specificity of human C16orf95 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C16ORF95
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C16orf95 Protein (NBP1-91131PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C16orf95 Antibody

  • AC010531.1
  • chromosome 16 open reading frame 95
  • DKFZp434J1815
  • FLJ22477
  • hypothetical protein LOC100506581

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00002300-D01P
Species: Hu
Applications: WB
AF313
Species: Hu
Applications: WB, Simple Western, IHC, Block
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-19088
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-84850
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2220
Species: Hu, Mu, Rt, Po, Ba, Bv, Ca, SyHa, Pm, Ze
Applications: WB, Simple Western, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KO
NBP1-71852
Species: Hu
Applications: WB, IP
NBP1-91131
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for C16orf95 Antibody (NBP1-91131) (0)

There are no publications for C16orf95 Antibody (NBP1-91131).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C16orf95 Antibody (NBP1-91131) (0)

There are no reviews for C16orf95 Antibody (NBP1-91131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C16orf95 Antibody (NBP1-91131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C16orf95 Products

Bioinformatics Tool for C16orf95 Antibody (NBP1-91131)

Discover related pathways, diseases and genes to C16orf95 Antibody (NBP1-91131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C16orf95 Antibody (NBP1-91131)

Discover more about diseases related to C16orf95 Antibody (NBP1-91131).

Blogs on C16orf95

There are no specific blogs for C16orf95, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C16orf95 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C16ORF95