ZC3H11A Antibody

Images

 
Western Blot: ZC3H11A Antibody [NBP1-82975] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-645
Immunohistochemistry-Paraffin: ZC3H11A Antibody [NBP1-82975] - Staining of human kidney shows moderate nuclear positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZC3H11A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLSTKQGEEPLVRLSLTERLGKRKFSAGGDSDPPLKRSLAQRLGKKVEAPETNIDKTPKKAQVSKSLKERLGMSADPDNEDATDKVNKVGEIHVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC3H11A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZC3H11A Protein (NBP1-82975PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZC3H11A Antibody

  • DKFZp686D03108
  • DKFZp686F14109
  • DKFZp781G2455
  • EC 4.1.1.31
  • EC 4.2.1.11
  • KIAA0663zinc finger CCCH-type domain containing 11A
  • ZC3HDC11A
  • zinc finger CCCH domain-containing protein 11A
  • zinc finger CCCH-type containing 11A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53095
Species: Hu, Mu, Rt, Po, Bv, Mk, Rb, Sh, Ze
Applications: WB, ICC/IF, IHC-P
NBP1-88200
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33397
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-55869
Species: Hu
Applications: ICC/IF
NBP1-92090
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-16134
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19120
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-85660
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84164
Species: Hu
Applications: IHC, IHC-P
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88723
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82975
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZC3H11A Antibody (NBP1-82975) (0)

There are no publications for ZC3H11A Antibody (NBP1-82975).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZC3H11A Antibody (NBP1-82975) (0)

There are no reviews for ZC3H11A Antibody (NBP1-82975). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZC3H11A Antibody (NBP1-82975) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZC3H11A Products

Bioinformatics Tool for ZC3H11A Antibody (NBP1-82975)

Discover related pathways, diseases and genes to ZC3H11A Antibody (NBP1-82975). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZC3H11A Antibody (NBP1-82975)

Discover more about diseases related to ZC3H11A Antibody (NBP1-82975).
 

Pathways for ZC3H11A Antibody (NBP1-82975)

View related products by pathway.

Research Areas for ZC3H11A Antibody (NBP1-82975)

Find related products by research area.

Blogs on ZC3H11A

There are no specific blogs for ZC3H11A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZC3H11A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3H11A