ZBTB48 Antibody - BSA Free

Western Blot: ZBTB48 Antibody [NBP2-88607] - WB Suggested Anti-ZBTB48 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Transfected 293T

Western Blot: ZBTB48 Antibody [NBP2-88607] - Host: Rabbit. Target Name: ZBTB48. Sample Type: 293T. Antibody Dilution: 1.0ug/mlZBTB48 is supported by BioGPS gene expression data to be expressed in HEK293T

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZBTB48 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZBTB48. Peptide sequence: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZBTB48
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZBTB48 Antibody - BSA Free

• GLI-Kruppel family member HKR3
• HKR3zinc finger and BTB domain-containing protein 48
• Krueppel-related zinc finger protein 3
• Protein HKR3
• zinc finger and BTB domain containing 48
• Zinc finger protein 855
• ZNF855pp9964

Background

ZBTB48 binds to and regulates the J and/or S elements in MHC II promoter

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZBTB48