ZBTB46 Antibody - Azide and BSA Free

Western Blot: ZBTB46 Antibody [H00140685-B01P] - Analysis of ZBTB46 expression in transfected 293T cell line by ZBTB46 polyclonal antibody. Lane 1: BTBD4 transfected lysate(64.79 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: ZBTB46 Antibody [H00140685-B01P] - Analysis of purified antibody to BTBD4 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, Flow, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZBTB46 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZBTB46 Antibody - Azide and BSA Free (H00140685-B01P) is a polyclonal antibody validated for use in WB, Flow and ICC/IF. Anti-ZBTB46 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZBTB46 (AAH52269.1, 1 a.a. - 589 a.a.) full-length human protein. MNNRKEDMEIASHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSEQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQACHDFIKAALDISIKSDASDELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGGSELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNRKNKETVRHITQQVEDDSRASSPVPSFLPTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKCPYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCSRVFMSAASVGIRHGSRRHGVCTDCAGRGMAGPLDHGGGGGEGSPEALFPGDGPYLEDPEDPRGEAEELGEDDEGLAPEDALLADDKDEEDSPRPRSPPGGPDKDFAWLS
• Specificity: ZBTB46 - zinc finger and BTB domain containing 46,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ZBTB46
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZBTB46 Antibody - Azide and BSA Free

• BTB (POZ) domain containing 4
• BTB/POZ domain-containing protein 4
• BTBD4
• dJ583P15.7
• dJ583P15.8
• FLJ13502
• RINZF
• zinc finger and BTB domain containing 46
• zinc finger and BTB domain-containing protein 46
• Zinc finger protein 340
• ZNF340

Background

ZBTB46 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZBTB46 Antibody (H00140685-B01P)(2)

Publications using H00140685-B01P

• Wen YC, Liu CL, Yeh HL Et al. PCK1 regulates neuroendocrine differentiation in a positive feedback loop of LIF/ZBTB46 signalling in castration-resistant prostate cancer British journal of cancer 2021-11-24 [PMID: 34815524] (ICC/IF, Human)
• Schierer S, Ostalecki C, Zinser E et al. Extracellular vesicles from mature dendritic cells (DC) differentiate monocytes into immature DC. Life Sci Alliance 2018-12-03 [PMID: 30519676]

Bioinformatics

• Gene Symbol: ZBTB46
• Entrez:
  • 140685(Human)
• Uniprot:
  • AAH52269.1(Human)