ZBTB25 Antibody (3F8)

Images

 
Sandwich ELISA: ZBTB25 Antibody (3F8) [H00007597-M06] - Detection limit for recombinant GST tagged ZBTB25 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZBTB25 Antibody (3F8) Summary

Immunogen
ZBTB25 (NP_008908.2, 331 a.a. - 435 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DTEPVELNCNFSFSRKRKMSCTICGHKFPRKSQLLEHMYTHKGKSYRYNRCQRFGNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILVE
Specificity
ZBTB25 - zinc finger and BTB domain containing 25 (3F8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZBTB25
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZBTB25 Antibody (3F8)

  • C14orf51
  • KUPchromosome 14 open reading frame 51
  • zinc finger and BTB domain containing 25
  • zinc finger and BTB domain-containing protein 25
  • Zinc finger protein 46
  • Zinc finger protein KUP
  • ZNF46zinc finger protein 46 (KUP)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NB100-2131
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-83295
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
H00008941-P01
Species: Hu
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01992
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC

Publications for ZBTB25 Antibody (H00007597-M06) (0)

There are no publications for ZBTB25 Antibody (H00007597-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBTB25 Antibody (H00007597-M06) (0)

There are no reviews for ZBTB25 Antibody (H00007597-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZBTB25 Antibody (H00007597-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZBTB25 Products

Bioinformatics Tool for ZBTB25 Antibody (H00007597-M06)

Discover related pathways, diseases and genes to ZBTB25 Antibody (H00007597-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBTB25 Antibody (H00007597-M06)

Discover more about diseases related to ZBTB25 Antibody (H00007597-M06).
 

Pathways for ZBTB25 Antibody (H00007597-M06)

View related products by pathway.

Blogs on ZBTB25

There are no specific blogs for ZBTB25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBTB25 Antibody (3F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB25
Entrez
Uniprot