ZAR1L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZAR1L Antibody [NBP1-90974] - Staining of human cell line U-251 MG shows positivity in nucleoli and vesicles.
Immunohistochemistry-Paraffin: ZAR1L Antibody [NBP1-90974] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZAR1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PRTLSSCSPWDGRDPQEPLPACGVTSPATGRRGLIRLRRDGDEAESKALPGPAEASQPQPPSRRSGADRQEEPGQLEESGEKDAPCPQETKSKQVPGDAASEPLRRPNFQF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZAR1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZAR1L Protein (NBP1-90974PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZAR1L Antibody

  • ZAR1-like protein
  • ZAR2
  • zygote arrest 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3757
Species: Hu
Applications: WB, ICC
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
MAB2476
Species: Hu
Applications: WB, IHC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-88473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24590
Species: Mu
Applications: WB, IHC-P
NBP1-85426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3674
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBL1-17958
Species: Hu
AF6548
Species: Hu, Mu
Applications: IHC

Publications for ZAR1L Antibody (NBP1-90974) (0)

There are no publications for ZAR1L Antibody (NBP1-90974).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZAR1L Antibody (NBP1-90974) (0)

There are no reviews for ZAR1L Antibody (NBP1-90974). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZAR1L Antibody (NBP1-90974) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZAR1L Products

ZAR1L NBP1-90974

Bioinformatics Tool for ZAR1L Antibody (NBP1-90974)

Discover related pathways, diseases and genes to ZAR1L Antibody (NBP1-90974). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZAR1L Antibody (NBP1-90974)

View related products by pathway.

PTMs for ZAR1L Antibody (NBP1-90974)

Learn more about PTMs related to ZAR1L Antibody (NBP1-90974).

Blogs on ZAR1L

There are no specific blogs for ZAR1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZAR1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZAR1L