YLPM1 Antibody

Images

 
Orthogonal Strategies: Western Blot: YLPM1 Antibody [NBP2-56737] - Analysis in human cell line U-2 OS and human cell line SK-MEL-30.
Immunocytochemistry/ Immunofluorescence: YLPM1 Antibody [NBP2-56737] - Staining of human cell line MCF7 shows localization to nuclear speckles. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

YLPM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGNKEPLADTSSNQQKNFKMQSAAFSIAADVKDVKAAQSNENLSDSQQEPPKSEVSEGPVEPSNWDQNVQSMETQIDKAQAVTQPVPLANKPVPAQST
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YLPM1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
YLPM1 Recombinant Protein Antigen (NBP2-56737PEP)

Reactivity Notes

Mouse 85%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for YLPM1 Antibody

  • C14orf170
  • YLPM1 YLP motif containing 1
  • ZAP113
  • ZAP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20940
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-335
Species: All-NA
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF4256
Species: Hu
Applications: WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-75540
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
3709-KS
Species: Hu
Applications: BA
NBP2-25250
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-34152
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61683
Species: Hu
Applications: ELISA, Flow, WB
NBP1-69341
Species: Hu
Applications: WB
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-56737
Species: Hu
Applications: WB, ICC/IF

Publications for YLPM1 Antibody (NBP2-56737) (0)

There are no publications for YLPM1 Antibody (NBP2-56737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YLPM1 Antibody (NBP2-56737) (0)

There are no reviews for YLPM1 Antibody (NBP2-56737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for YLPM1 Antibody (NBP2-56737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional YLPM1 Products

Array NBP2-56737

Bioinformatics Tool for YLPM1 Antibody (NBP2-56737)

Discover related pathways, diseases and genes to YLPM1 Antibody (NBP2-56737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on YLPM1

There are no specific blogs for YLPM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YLPM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YLPM1