Yes Antibody (3C6) - Azide and BSA Free

Western Blot: Yes Antibody (3C6) [H00007525-M02] - YES1 monoclonal antibody (M02), clone 3C6. Analysis of YES1 expression in Hela S3 NE.

Western Blot: Yes Antibody (3C6) [H00007525-M02] - YES1 monoclonal antibody (M02), clone 3C6 Analysis of YES1 expression in Jurkat.

Proximity Ligation Assay: Yes Antibody (3C6) [H00007525-M02] - Analysis of protein-protein interactions between PTK2B and YES1. Huh7 cells were stained with anti-PTK2B rabbit purified polyclonal 1:1200 and anti-YES1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

• Reactivity: Hu
• Applications: WB, ELISA, Func
• Clone: 3C6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Yes Antibody (3C6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: YES1 (AAH48960, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV
• Specificity: YES1 - v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: YES1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Yes Antibody (3C6) - Azide and BSA Free

• cellular yes-1 protein
• c-yes
• EC 2.7.10
• EC 2.7.10.2
• HsT441
• P61-YES
• Proto-oncogene c-Yes
• proto-oncogene tyrosine-protein kinase Yes
• v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
• Yamaguchi sarcoma oncogene
• Yes
• YES1

Background

This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: YES1
• Entrez:
  • 7525(Human)
• OMIM:
  • 164880(Human)
• Uniprot:
  • AAH48960(Human)