YB1 Recombinant Protein Antigen

Images

 
There are currently no images for YB1 Recombinant Protein Antigen (NBP2-58086PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

YB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human YB1.

Source: E. coli

Amino Acid Sequence: TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
YBX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58086.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for YB1 Recombinant Protein Antigen

  • BP-8
  • CBF-A
  • class II, Y box-binding protein I
  • CSDA2
  • CSDB
  • DBPB CCAAT-binding transcription factor I subunit A
  • EFI-A
  • Enhancer factor I subunit A
  • MDR-NF1
  • MGC104858
  • MGC110976
  • MGC117250
  • NSEP1 Y-box-binding protein 1
  • nuclease-sensitive element-binding protein 1
  • Y box binding protein 1
  • YB1 DNA-binding protein B
  • YB-1 Y-box transcription factor
  • YBX1

Background

The Y-box binding protein 1 (YB1) is a pluripotent DNA/RNA-binding factor which regulates gene expression through transcription and translation. YB1 has been shown to be a marker of tumor aggressiveness and belongs to the cold-shock domain family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004782-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-81407
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-81000
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
NBP1-84999
Species: Hu
Applications: IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
NBP2-15039
Species: Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP2-58086PEP
Species: Hu
Applications: AC

Publications for YB1 Recombinant Protein Antigen (NBP2-58086PEP) (0)

There are no publications for YB1 Recombinant Protein Antigen (NBP2-58086PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YB1 Recombinant Protein Antigen (NBP2-58086PEP) (0)

There are no reviews for YB1 Recombinant Protein Antigen (NBP2-58086PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for YB1 Recombinant Protein Antigen (NBP2-58086PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional YB1 Products

Research Areas for YB1 Recombinant Protein Antigen (NBP2-58086PEP)

Find related products by research area.

Blogs on YB1.

Understanding ‘Y’ in Breast Cancer: Crucial Role of DNA/RNA-binding Protein YB-1 in the Development, Pre-Invasive, and Metastatic Phases
Jamshed Arslan, Pharm D, PhD In the United States, 1 in 8 women will be diagnosed with breast cancer in her lifetime.1 Despite the prevalence, cancer genesis is a mystery. The heterogeneity of cancers makes it diff...  Read full blog post.

New Techniques Using Phosphoserine Antibodies
Phosphoserine, the phosphorylated modification of the amino acid serine, is a central post-translational modification within a cell for many biological and biomedical processes. The phosphorylation of specifically four residue types - histidine, serin...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our YB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol YBX1