YARS2 Antibody

Images

 
Immunohistochemistry-Paraffin: YARS2 Antibody [NBP1-84525] - Staining of human stomach shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YARS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSTTGAKLGKSAGNAVWLNRDKTSPFELYQFFVRQPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVHGREG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YARS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
YARS2 Protein (NBP1-84525PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for YARS2 Antibody

  • CGI-04
  • EC 6.1.1.1
  • FLJ13995
  • MLASA2
  • mt-TyrRS
  • tyrosine tRNA ligase 2, mitochondrial
  • Tyrosine--tRNA ligase
  • tyrosyl-tRNA synthetase 2, mitochondrial
  • tyrosyl-tRNA synthetase, mitochondrial
  • TYRRS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-54653
Species: Hu
Applications: WB
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83059
Species: Hu
Applications: IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82077
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for YARS2 Antibody (NBP1-84525) (0)

There are no publications for YARS2 Antibody (NBP1-84525).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YARS2 Antibody (NBP1-84525) (0)

There are no reviews for YARS2 Antibody (NBP1-84525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for YARS2 Antibody (NBP1-84525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional YARS2 Products

Bioinformatics Tool for YARS2 Antibody (NBP1-84525)

Discover related pathways, diseases and genes to YARS2 Antibody (NBP1-84525). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YARS2 Antibody (NBP1-84525)

Discover more about diseases related to YARS2 Antibody (NBP1-84525).
 

Pathways for YARS2 Antibody (NBP1-84525)

View related products by pathway.

Blogs on YARS2

There are no specific blogs for YARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YARS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YARS2