YAP1 Antibody

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-62669] - Analysis in human smooth muscle and liver tissues using Anti-YAP1 antibody. Corresponding YAP1 RNA-seq data are presented for the same tissues. Dilution: 1:1000 - 1:2500.

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-62669] - Staining of human smooth muscle shows high expression. Dilution: 1:1000 - 1:2500.

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-62669] - Staining of human liver shows low expression as expected. Dilution: 1:1000 - 1:2500.

Product Discontinued

YAP1 Antibody Summary

• Immunogen: This YAP1 antibody was developed against a recombinant protein corresponding to amino acids: QLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPF
• Specificity: Expected cross-reactivity based on immunogen sequence should react to all isotypes.
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: YAP1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for YAP1 Antibody

• 65 kDa Yes-associated protein
• COB1
• Protein Yorkie Homolog
• Transcriptional Coactivator YAP1
• YAP
• YAP1
• YAP1-2gamma
• YAP2
• YAP2L
• YAP65
• YAP65yes-associated protein 2
• Yes Associated Protein
• Yes-associated protein 1
• Yes-associated protein 1, 65kDa
• yes-associated protein beta
• yes-associated protein delta
• Yes-Associated Protein YAP65 Homolog
• Yes-Associated Protein
• YKI
• Yorkie Homolog

Background

The transcriptional coactivator Yes-associated protein (YAP), also known as Yes-associated protein 1 (YAP1), Yes-Associated Protein YAP65 Homolog, Protein Yorkie Homolog and YAP65 has a theoretical molecular weight of 65 kDa. The YAP1 gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. YAP1 shares homology with the WW domain of transcriptional co-activator with PDZ-binding motif (TAZ), which functions as a transcriptional co-activator by binding to the PPXY motif present in transcription factors and is likely involved in protein-protein interaction. YAP has been identified as a core regulatory mechanism that blocks mammalian glial cell proliferation and cellular reprogramming following damage (1).

YAP plays a role in the development and progression of multiple cancers as a transcriptional regulator of the Hippo signaling pathway. YAP1 encodes a nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis to play a pivotal role in controlling cell growth and organ size and has emerged as a key player in tumor suppression (2,3). Deregulation of the Hippo pathway causes tumor formation and malignancy, with YAP being a key oncogenic driver in liver carcinogenesis (2) and may function as a potential target for cancer treatment (3).

References

1. Rueda, E. M., Hall, B. M., Hill, M. C., Swinton, P. G., Tong, X., Martin, J. F., & Poche, R. A. (2019). The Hippo Pathway Blocks Mammalian Retinal Muller Glial Cell Reprogramming. Cell Rep, 27(6), 1637-1649.e1636. doi:10.1016/j.celrep.2019.04.047

2. Liu, A. M., Xu, M. Z., Chen, J., Poon, R. T., & Luk, J. M. (2010). Targeting YAP and Hippo signaling pathway in liver cancer. Expert Opin Ther Targets, 14(8), 855-868. doi:10.1517/14728222.2010.499361

3.Ye, S., & Eisinger-Mathason, T. S. (2016). Targeting the Hippo pathway: Clinical implications and therapeutics. Pharmacol Res, 103, 270-278. doi:10.1016/j.phrs.2015.11.025

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: YAP1