XAB1 Recombinant Protein Antigen

Images

 
There are currently no images for XAB1 Protein (NBP1-90072PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

XAB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPN1.

Source: E. coli

Amino Acid Sequence: LNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90072.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for XAB1 Recombinant Protein Antigen

  • ATP(GTP)-binding protein
  • ATPBD1A
  • GPN-loop GTPase 1
  • GTPase
  • MBD2-interacting protein
  • MBDin
  • MBDINXPA binding protein 1
  • XAB1FLJ51176
  • XPA-binding protein 1

Background

The DNA methylation system is composed of methyl-CpG-binding proteins, as well as of DNA cytosine methyl transferases. Five methyl-CpG binding proteins were isolated: MeCP2, MBD1, MBD2, MBD3 and MBD4. MBD2 consists of two isoforms, MBD2a and MBD2b, which are generated from a single gene. MBD2a is a component of MeCP1, a large corepressor complex that represses transcription from densely methylated genes. Components of MeCP1 include MBD2, Mi-2, MTA2, MBD3 and HDAC1/2. MIZF and MBDin were isolated as proteins interacting with MBD2. MBDin, in turn, is identical to XPA binding protein 1 (XAB1). At the N erminus, the protein contains the consensus sequence for a GTP binding site. At the C terminus, the protein is characterized by an acidic domain containing a cluster of acidic amino acid residues. The transcriptional repression by MBD2 at methylated promoters is relieved by MBdin. XAB1 is expressed ubiquitously, and may be involved in nuclear localization of XPA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB100-1805
Species: Hu, Mu, Ye
Applications: IHC,  IHC-P, IP, Single-Cell Western, WB
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
AF3416
Species: Hu
Applications: WB
NBP2-53092
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP2-92242
Species: Hu, Mu, Rt
Applications: WB
AF2128
Species: Mu
Applications: IHC, WB
NB100-79802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP3-12450
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF3297
Species: Hu
Applications: WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5720
Species: Hu
Applications: Simple Western, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP3-15704
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB

Publications for XAB1 Protein (NBP1-90072PEP) (0)

There are no publications for XAB1 Protein (NBP1-90072PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XAB1 Protein (NBP1-90072PEP) (0)

There are no reviews for XAB1 Protein (NBP1-90072PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XAB1 Protein (NBP1-90072PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XAB1 Products

Array NBP1-90072PEP

Research Areas for XAB1 Protein (NBP1-90072PEP)

Find related products by research area.

Blogs on XAB1

There are no specific blogs for XAB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XAB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPN1