XAB1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPN1. Source: E. coli
Amino Acid Sequence: LNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GPN1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90072. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for XAB1 Recombinant Protein Antigen
Background
The DNA methylation system is composed of methyl-CpG-binding proteins, as well as of DNA cytosine methyl transferases. Five methyl-CpG binding proteins were isolated: MeCP2, MBD1, MBD2, MBD3 and MBD4. MBD2 consists of two isoforms, MBD2a and MBD2b, which are generated from a single gene. MBD2a is a component of MeCP1, a large corepressor complex that represses transcription from densely methylated genes. Components of MeCP1 include MBD2, Mi-2, MTA2, MBD3 and HDAC1/2. MIZF and MBDin were isolated as proteins interacting with MBD2. MBDin, in turn, is identical to XPA binding protein 1 (XAB1). At the N erminus, the protein contains the consensus sequence for a GTP binding site. At the C terminus, the protein is characterized by an acidic domain containing a cluster of acidic amino acid residues. The transcriptional repression by MBD2 at methylated promoters is relieved by MBdin. XAB1 is expressed ubiquitously, and may be involved in nuclear localization of XPA.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu, Mu, Ye
Applications: IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Publications for XAB1 Protein (NBP1-90072PEP) (0)
There are no publications for XAB1 Protein (NBP1-90072PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for XAB1 Protein (NBP1-90072PEP) (0)
There are no reviews for XAB1 Protein (NBP1-90072PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for XAB1 Protein (NBP1-90072PEP) (0)
Additional XAB1 Products
Research Areas for XAB1 Protein (NBP1-90072PEP)
Find related products by research area.
|
Blogs on XAB1