Recombinant Human WWP2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human WWP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-335 of Human WWP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
WWP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
61.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WWP2 Protein

  • AIP2Nedd-4-like ubiquitin-protein ligase
  • atrophin-1 interacting protein 2
  • Atrophin-1-interacting protein 2
  • EC 6.3.2
  • EC 6.3.2.-
  • NEDD4-like E3 ubiquitin-protein ligase WWP2
  • WW domain containing E3 ubiquitin protein ligase 2
  • WW domain-containing protein 2
  • WWp2-like

Background

This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. The encoded protein contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89180
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27197
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00011059-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00060485-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP1-90201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-81436
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91683
Species: Hu
Applications: WB, IHC, IHC-P
H00011060-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for WWP2 Recombinant Protein (H00011060-P01) (0)

There are no publications for WWP2 Recombinant Protein (H00011060-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WWP2 Recombinant Protein (H00011060-P01) (0)

There are no reviews for WWP2 Recombinant Protein (H00011060-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WWP2 Recombinant Protein (H00011060-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WWP2 Products

Bioinformatics Tool for WWP2 Recombinant Protein (H00011060-P01)

Discover related pathways, diseases and genes to WWP2 Recombinant Protein (H00011060-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WWP2 Recombinant Protein (H00011060-P01)

Discover more about diseases related to WWP2 Recombinant Protein (H00011060-P01).
 

Pathways for WWP2 Recombinant Protein (H00011060-P01)

View related products by pathway.

PTMs for WWP2 Recombinant Protein (H00011060-P01)

Learn more about PTMs related to WWP2 Recombinant Protein (H00011060-P01).

Blogs on WWP2

There are no specific blogs for WWP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WWP2 Antibody
NBP1-49942
OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WWP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WWP2