Recombinant Human WSTF Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human WSTF Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1384-1483 of Human BAZ1B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BAZ1B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WSTF Protein

  • bromodomain adjacent to zinc finger domain, 1B
  • williams-Beuren syndrome chromosomal region 10 protein

Background

BAZ1B - bromodomain adjacent to zinc finger domain, 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-55310
Species: Hu, Mu
Applications: WB, IP
NB100-61041
Species: Hu
Applications: WB, IP
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59158
Species: Hu, Mu
Applications: WB, ChIP
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
MAB7650
Species: Mu
Applications: WB, IHC
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WSTF Partial Recombinant Protein (H00009031-Q01) (0)

There are no publications for WSTF Partial Recombinant Protein (H00009031-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WSTF Partial Recombinant Protein (H00009031-Q01) (0)

There are no reviews for WSTF Partial Recombinant Protein (H00009031-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WSTF Partial Recombinant Protein (H00009031-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WSTF Products

Bioinformatics Tool for WSTF Partial Recombinant Protein (H00009031-Q01)

Discover related pathways, diseases and genes to WSTF Partial Recombinant Protein (H00009031-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WSTF Partial Recombinant Protein (H00009031-Q01)

Discover more about diseases related to WSTF Partial Recombinant Protein (H00009031-Q01).
 

Pathways for WSTF Partial Recombinant Protein (H00009031-Q01)

View related products by pathway.

PTMs for WSTF Partial Recombinant Protein (H00009031-Q01)

Learn more about PTMs related to WSTF Partial Recombinant Protein (H00009031-Q01).
 

Research Areas for WSTF Partial Recombinant Protein (H00009031-Q01)

Find related products by research area.

Blogs on WSTF

There are no specific blogs for WSTF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WSTF Antibody
NB600-279

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WSTF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BAZ1B