Recombinant Human WRN Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human WRN Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1322-1432 of Human WRN

Source: Wheat Germ

Amino Acid Sequence: NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
WRN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00007486-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WRN Protein

  • DKFZp686C2056
  • DNA helicase, RecQ-like type 3
  • EC 3.1
  • EC 3.6.1
  • EC 3.6.4.12
  • Exonuclease WRN
  • RecQ protein-like 2
  • RecQ3
  • RECQ3RECQL3
  • RECQL2Werner syndrome ATP-dependent helicase
  • Werner syndrome
  • Werner syndrome, RecQ helicase-like

Background

WRN - Werner syndrome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-83438
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-56408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-13732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
H00007486-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for WRN Partial Recombinant Protein (H00007486-Q01)(1)

Reviews for WRN Partial Recombinant Protein (H00007486-Q01) (0)

There are no reviews for WRN Partial Recombinant Protein (H00007486-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WRN Partial Recombinant Protein (H00007486-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for WRN Partial Recombinant Protein (H00007486-Q01)

Discover related pathways, diseases and genes to WRN Partial Recombinant Protein (H00007486-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WRN Partial Recombinant Protein (H00007486-Q01)

Discover more about diseases related to WRN Partial Recombinant Protein (H00007486-Q01).
 

Pathways for WRN Partial Recombinant Protein (H00007486-Q01)

View related products by pathway.

PTMs for WRN Partial Recombinant Protein (H00007486-Q01)

Learn more about PTMs related to WRN Partial Recombinant Protein (H00007486-Q01).
 

Research Areas for WRN Partial Recombinant Protein (H00007486-Q01)

Find related products by research area.

Blogs on WRN.

Not as Pluripotent as You Used to Be: Embryonic Stem Cell Markers and the Aging Process
We at Novus Biologicals recently extended our antibody catalog to include several embryonic stem cells (ESC) antibodies validated for use in FACS (fluorescent activated cell sorting) assays. Among them was Oct4, which recently became the focus of an i...  Read full blog post.

Customers Who Bought This Also Bought

Mre11 Antibody
NB100-142
WRN Antibody
NB100-471
ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WRN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WRN