Wnt-2b Antibody

Images

 
Immunohistochemistry-Paraffin: Wnt-2b Antibody [NBP2-32562] - Staining of human kidney shows strong cytoplasmic, nuclear and membranous positivity in proximal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Wnt-2b Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNT2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Wnt-2b Protein (NBP2-32562PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Wnt-2b Antibody

  • Protein Wnt-13
  • protein Wnt-2b
  • wingless-type MMTV integration site family, member 2B
  • Wnt-13
  • WNT13XWNT2, Xenopus, homolog of
  • Wnt2b
  • Wnt-2b
  • XWNT2
  • XWNT2wingless-type MMTV integration site family, member 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

3669-WN/CF
Species: Mu
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
7196-WN/CF
Species: Hu
AF3157
Species: Hu
Applications: WB, IHC
645-WN/CF
Species: Hu, Mu
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15163
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46367
Species: Hu
Applications: WB, IHC
AF4109
Species: Hu
Applications: WB, IHC
AF3367
Species: Hu, Mu
Applications: WB
AF2248
Species: Mu
Applications: WB, IHC
NBP1-76916
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
3008-WN/CF
Species: Hu
AF1617
Species: Hu
Applications: WB
AF475
Species: Mu
Applications: WB, IHC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-32562
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Wnt-2b Antibody (NBP2-32562) (0)

There are no publications for Wnt-2b Antibody (NBP2-32562).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt-2b Antibody (NBP2-32562) (0)

There are no reviews for Wnt-2b Antibody (NBP2-32562). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Wnt-2b Antibody (NBP2-32562) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Wnt-2b Products

Bioinformatics Tool for Wnt-2b Antibody (NBP2-32562)

Discover related pathways, diseases and genes to Wnt-2b Antibody (NBP2-32562). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-2b Antibody (NBP2-32562)

Discover more about diseases related to Wnt-2b Antibody (NBP2-32562).
 

Pathways for Wnt-2b Antibody (NBP2-32562)

View related products by pathway.

PTMs for Wnt-2b Antibody (NBP2-32562)

Learn more about PTMs related to Wnt-2b Antibody (NBP2-32562).
 

Research Areas for Wnt-2b Antibody (NBP2-32562)

Find related products by research area.

Blogs on Wnt-2b

There are no specific blogs for Wnt-2b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-2b Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT2B
Entrez