WNK2 Antibody

Images

 
Western Blot: WNK2 Antibody [NBP2-33876] - Analysis in human cell line SCLC-21H.
Orthogonal Strategies: Immunohistochemistry-Paraffin: WNK2 Antibody [NBP2-33876] - Staining in human fallopian tube and liver tissues using anti-WNK2 antibody. Corresponding WNK2 RNA-seq data are presented for ...read more
Western Blot: WNK2 Antibody [NBP2-33876] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: WNK2 Antibody [NBP2-33876] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WNK2 Antibody [NBP2-33876] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

WNK2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GTSSSMTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPHSLR
Specificity
Specificity of human WNK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WNK2 Protein (NBP2-33876PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WNK2 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • PRK
  • PRKWNK2
  • Protein kinase with no lysine 2
  • SDCCAG43
  • serine/threonine-protein kinase WNK2
  • Serologically defined colon cancer antigen 43lysine deficient 2
  • WNK lysine deficient protein kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
AF3575
Species: Hu
Applications: WB, ICC
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-67180
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4559
Species: Hu
Applications: WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46228
Species: Hu
Applications: WB, IHC

Publications for WNK2 Antibody (NBP2-33876) (0)

There are no publications for WNK2 Antibody (NBP2-33876).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WNK2 Antibody (NBP2-33876) (0)

There are no reviews for WNK2 Antibody (NBP2-33876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WNK2 Antibody (NBP2-33876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for WNK2 Antibody (NBP2-33876)

Discover related pathways, diseases and genes to WNK2 Antibody (NBP2-33876). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WNK2 Antibody (NBP2-33876)

Discover more about diseases related to WNK2 Antibody (NBP2-33876).
 

Pathways for WNK2 Antibody (NBP2-33876)

View related products by pathway.

PTMs for WNK2 Antibody (NBP2-33876)

Learn more about PTMs related to WNK2 Antibody (NBP2-33876).
 

Research Areas for WNK2 Antibody (NBP2-33876)

Find related products by research area.

Blogs on WNK2

There are no specific blogs for WNK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WNK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNK2
Uniprot