WISP2 Antibody (1E11.)

Images

 
Western Blot: WISP2 Antibody (1E11) [H00008839-M02] - Analysis of WISP2 expression in transfected 293T cell line by WISP2 monoclonal antibody (M02), clone 1E11.Lane 1: WISP2 transfected lysate(26.8 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E11.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

WISP2 Antibody (1E11.) Summary

Immunogen
WISP2 (AAH17782.1, 24 a.a. - 250 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDCSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WISP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WISP2 Antibody (1E11.)

  • CCN5CCN family member 5
  • Connective tissue growth factor-like protein
  • Connective tissue growth factor-related protein 58
  • CT58CTGF-Lwnt-1 signaling pathway protein 2
  • CTGFL
  • WISP-2
  • WNT1 inducible signaling pathway protein 2
  • WNT1-inducible-signaling pathway protein 2

Background

This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-356
Species: Hu, Rb
Applications: WB, Simple Western, B/N, ICC/IF, IHC, IHC-P
NBP2-56060
Species: Hu
Applications: ICC/IF
AF1680
Species: Mu
Applications: WB, IHC
NBP1-33041
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31330
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF1620
Species: Mu
Applications: WB, IHC
NBP2-02609
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for WISP2 Antibody (H00008839-M02) (0)

There are no publications for WISP2 Antibody (H00008839-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WISP2 Antibody (H00008839-M02) (0)

There are no reviews for WISP2 Antibody (H00008839-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WISP2 Antibody (H00008839-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WISP2 Products

Bioinformatics Tool for WISP2 Antibody (H00008839-M02)

Discover related pathways, diseases and genes to WISP2 Antibody (H00008839-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WISP2 Antibody (H00008839-M02)

Discover more about diseases related to WISP2 Antibody (H00008839-M02).
 

Pathways for WISP2 Antibody (H00008839-M02)

View related products by pathway.

PTMs for WISP2 Antibody (H00008839-M02)

Learn more about PTMs related to WISP2 Antibody (H00008839-M02).

Blogs on WISP2

There are no specific blogs for WISP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WISP2 Antibody (1E11.) and receive a gift card or discount.

Bioinformatics

Gene Symbol WISP2
Uniprot